Psyllid ID: psy2059


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120------
MTIDFYYVPGSAPCRAVQLAAAQIGVPLNLKHTDLMKGEHLTPEFLKLNPQHTVPYSQQTNSQEYRREESRAIIAYLAEQYGKDDSLYPKDPKARGIVNQRLYFDIGTLYQRFADYFVSTLFIILT
cccEEEcccccccHHHHHHHHHHHccccEEEEccccccccccHHHHHHcccccccEEEEcccccEEEEccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccc
cccEEEEccccHHHHHHHHHHHHHccccEEEEccccccccccHHHHHHcccccccEEEEEccccEEEEcHHHHHHHHHHHHcccHHHccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHcEEcc
mtidfyyvpgsapcRAVQLAAAQigvplnlkhtdlmkgehltpeflklnpqhtvpysqqtnsqEYRREESRAIIAYLAEqygkddslypkdpkargivnqrLYFDIGTLYQRFADYFVSTLFIILT
MTIDFYYVPGSAPCRAVQLAAAQIGVPLNLKHTDLMKGEHLTPEFLKLNPQHTVPysqqtnsqeyRREESRAIIAYLAEqygkddslypkdpkargiVNQRLYFDIGTLYQRFADYFVSTLFIILT
MTIDFYYVPGSAPCRAVQLAAAQIGVPLNLKHTDLMKGEHLTPEFLKLNPQHTVPYSQQTNSQEYRREESRAIIAYLAEQYGKDDSLYPKDPKARGIVNQRLYFDIGTLYQRFADYFVSTLFIILT
**IDFYYVPGSAPCRAVQLAAAQIGVPLNLKHTDLMKGEHLTPEFLKL***********************AIIAYLAEQYGKDDSLYPKDPKARGIVNQRLYFDIGTLYQRFADYFVSTLFIIL*
MTIDFYYVPGSAPCRAVQLAAAQIGVPLNLKHTDLMKGEHLTPEFLKLNPQHTVPYSQQTNSQEYRREESRAIIAYLAEQYGKDDSLYPKDPKARGIVNQRLYFDIGTLYQRFADYFVSTLFIILT
MTIDFYYVPGSAPCRAVQLAAAQIGVPLNLKHTDLMKGEHLTPEFLKLNPQHTVP************EESRAIIAYLAEQYGKDDSLYPKDPKARGIVNQRLYFDIGTLYQRFADYFVSTLFIILT
*TIDFYYVPGSAPCRAVQLAAAQIGVPLNLKHTDLMKGEHLTPEFLKLNPQHTVPYSQQTNSQEYRREESRAIIAYLAEQYGKDDSLYPKDPKARGIVNQRLYFDIGTLYQRFADYFVSTLFIILT
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTIDFYYVPGSAPCRAVQLAAAQIGVPLNLKHTDLMKGEHLTPEFLKLNPQHTVPYSQQTNSQEYRREESRAIIAYLAEQYGKDDSLYPKDPKARGIVNQRLYFDIGTLYQRFADYFVSTLFIILT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query126 2.2.26 [Sep-21-2011]
Q93112209 Glutathione S-transferase yes N/A 0.928 0.559 0.658 5e-43
Q93113209 Glutathione S-transferase no N/A 0.928 0.559 0.675 1e-42
O77473216 Glutathione S-transferase no N/A 0.928 0.541 0.650 6e-41
P42860208 Glutathione S-transferase N/A N/A 0.928 0.562 0.566 2e-36
P28338208 Glutathione S-transferase N/A N/A 0.928 0.562 0.566 4e-36
P20432209 Glutathione S-transferase yes N/A 0.928 0.559 0.575 9e-36
P67805209 Glutathione S-transferase N/A N/A 0.920 0.555 0.579 2e-35
P30108209 Glutathione S-transferase N/A N/A 0.920 0.555 0.579 2e-35
P30106209 Glutathione S-transferase N/A N/A 0.920 0.555 0.579 3e-35
O77462186 Glutathione S-transferase no N/A 0.936 0.634 0.568 4e-35
>sp|Q93112|GST1C_ANOGA Glutathione S-transferase 1, isoform C OS=Anopheles gambiae GN=GstD1 PE=1 SV=2 Back     alignment and function desciption
 Score =  172 bits (437), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 79/120 (65%), Positives = 94/120 (78%), Gaps = 3/120 (2%)

Query: 3   IDFYYVPGSAPCRAVQLAAAQIGVPLNLKHTDLMKGEHLTPEFLKLNPQHTVPYSQQTNS 62
           +DFYY+PGSAPCRAVQ+ AA +GV LNLK TDLMKGEH+ PEFLK+NPQH +P       
Sbjct: 1   MDFYYLPGSAPCRAVQMTAAAVGVELNLKLTDLMKGEHMKPEFLKINPQHCIP---TLVD 57

Query: 63  QEYRREESRAIIAYLAEQYGKDDSLYPKDPKARGIVNQRLYFDIGTLYQRFADYFVSTLF 122
             +   ESRAI  YLAE+YGKDD LYPKDP+ R +VNQR+YFD+GTLYQRFADY+   +F
Sbjct: 58  NGFALWESRAICTYLAEKYGKDDKLYPKDPQKRAVVNQRMYFDMGTLYQRFADYYYPQIF 117




Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Has DDT dehydrochlorinase activity.
Anopheles gambiae (taxid: 7165)
EC: 4EC: .EC: 5EC: .EC: 1EC: .EC: 1
>sp|Q93113|GST1D_ANOGA Glutathione S-transferase 1, isoform D OS=Anopheles gambiae GN=GstD1 PE=1 SV=1 Back     alignment and function description
>sp|O77473|GST1B_ANOGA Glutathione S-transferase 1, isoform B OS=Anopheles gambiae GN=GstD1 PE=2 SV=2 Back     alignment and function description
>sp|P42860|GSTT1_LUCCU Glutathione S-transferase 1-1 OS=Lucilia cuprina GN=GST1 PE=1 SV=2 Back     alignment and function description
>sp|P28338|GSTT1_MUSDO Glutathione S-transferase 1 OS=Musca domestica GN=Gst1 PE=2 SV=1 Back     alignment and function description
>sp|P20432|GSTT1_DROME Glutathione S-transferase 1-1 OS=Drosophila melanogaster GN=GstD1 PE=1 SV=1 Back     alignment and function description
>sp|P67805|GSTT1_DROSI Glutathione S-transferase 1-1 OS=Drosophila simulans GN=GstD1 PE=2 SV=2 Back     alignment and function description
>sp|P30108|GSTT1_DROYA Glutathione S-transferase 1-1 OS=Drosophila yakuba GN=GstD1 PE=3 SV=2 Back     alignment and function description
>sp|P30106|GSTT1_DROSE Glutathione S-transferase 1-1 OS=Drosophila sechellia GN=GstD1 PE=3 SV=2 Back     alignment and function description
>sp|O77462|GST1A_ANOGA Glutathione S-transferase 1, isoform A OS=Anopheles gambiae GN=GstD1 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query126
359326583216 glutathione S transferase class delta [B 0.944 0.550 0.688 2e-43
154936819216 glutathione S-transferase [Blattella ger 0.944 0.550 0.688 2e-43
161137518216 delta class glutathione S-transferase [B 0.944 0.550 0.688 2e-43
388523609216 glutathione s-transferase d1 [Cryptocerc 0.944 0.550 0.688 6e-43
359326557216 glutathione S transferase class delta va 0.944 0.550 0.680 6e-42
91080623216 PREDICTED: similar to glutathione S-tran 0.944 0.550 0.672 6e-42
270005507 411 hypothetical protein TcasGA2_TC007571 [T 0.944 0.289 0.672 2e-41
1632771209 GSTD1-5 protein [Anopheles gambiae] 0.928 0.559 0.658 3e-41
31208165209 AGAP004164-PA [Anopheles gambiae str. PE 0.928 0.559 0.658 3e-41
403182396209 AAEL001061-PB [Aedes aegypti] 0.928 0.559 0.675 4e-41
>gi|359326583|gb|AEV23880.1| glutathione S transferase class delta [Blattella germanica] Back     alignment and taxonomy information
 Score =  180 bits (456), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 84/122 (68%), Positives = 98/122 (80%), Gaps = 3/122 (2%)

Query: 1   MTIDFYYVPGSAPCRAVQLAAAQIGVPLNLKHTDLMKGEHLTPEFLKLNPQHTVPYSQQT 60
           MTIDFYY+PGSAPCR+V LAA   GV LNLK T+LM GEHLTPEFLK+NPQHT+P     
Sbjct: 1   MTIDFYYLPGSAPCRSVLLAAKAFGVDLNLKVTNLMAGEHLTPEFLKMNPQHTIP---TL 57

Query: 61  NSQEYRREESRAIIAYLAEQYGKDDSLYPKDPKARGIVNQRLYFDIGTLYQRFADYFVST 120
           N   +   ESRAI++YLA+QYGKDDSLYPKDPK R +V+QRLYFD+GTLYQRF DY+   
Sbjct: 58  NDNGFCLWESRAILSYLADQYGKDDSLYPKDPKKRALVDQRLYFDLGTLYQRFGDYYYPI 117

Query: 121 LF 122
           +F
Sbjct: 118 MF 119




Source: Blattella germanica

Species: Blattella germanica

Genus: Blattella

Family: Ectobiidae

Order: Blattodea

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|154936819|emb|CAO85744.1| glutathione S-transferase [Blattella germanica] Back     alignment and taxonomy information
>gi|161137518|gb|ABX57814.1| delta class glutathione S-transferase [Blattella germanica] Back     alignment and taxonomy information
>gi|388523609|gb|AFK49803.1| glutathione s-transferase d1 [Cryptocercus punctulatus] Back     alignment and taxonomy information
>gi|359326557|gb|AEV23867.1| glutathione S transferase class delta variant 1 [Periplaneta americana] gi|359326559|gb|AEV23868.1| glutathione S transferase class delta variant 2 [Periplaneta americana] Back     alignment and taxonomy information
>gi|91080623|ref|XP_974273.1| PREDICTED: similar to glutathione S-transferase [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270005507|gb|EFA01955.1| hypothetical protein TcasGA2_TC007571 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|1632771|emb|CAB03592.1| GSTD1-5 protein [Anopheles gambiae] Back     alignment and taxonomy information
>gi|31208165|ref|XP_313049.1| AGAP004164-PA [Anopheles gambiae str. PEST] gi|97536307|sp|Q93112.2|GST1C_ANOGA RecName: Full=Glutathione S-transferase 1, isoform C; AltName: Full=AgGst1-alpha; AltName: Full=Aggst1-5; AltName: Full=DDT-dehydrochlorinase; AltName: Full=GST class-theta gi|3511226|gb|AAC79993.1| glutathione S-transferase [Anopheles gambiae] gi|30177067|gb|EAA08605.2| AGAP004164-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|403182396|gb|EJY57354.1| AAEL001061-PB [Aedes aegypti] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query126
UNIPROTKB|O77473216 GstD1 "Glutathione S-transfera 0.928 0.541 0.658 3.4e-38
FB|FBgn0001149209 GstD1 "Glutathione S transfera 0.928 0.559 0.583 9.5e-34
UNIPROTKB|O77462186 GstD1 "Glutathione S-transfera 0.936 0.634 0.568 8.5e-33
FB|FBgn0038020218 GstD9 "Glutathione S transfera 0.928 0.536 0.525 2.3e-30
FB|FBgn0010038215 GstD2 "Glutathione S transfera 0.888 0.520 0.539 1.3e-29
FB|FBgn0010044212 GstD8 "Glutathione S transfera 0.873 0.518 0.548 4.4e-29
UNIPROTKB|O76483218 GstD7 "Glutathione S-transfera 0.936 0.541 0.520 1.2e-28
FB|FBgn0010041216 GstD5 "Glutathione S transfera 0.888 0.518 0.521 1.9e-28
FB|FBgn0010040215 GstD4 "Glutathione S transfera 0.888 0.520 0.521 6.4e-28
FB|FBgn0042206210 GstD10 "Glutathione S transfer 0.936 0.561 0.475 8.2e-28
UNIPROTKB|O77473 GstD1 "Glutathione S-transferase 1, isoform B" [Anopheles gambiae (taxid:7165)] Back     alignment and assigned GO terms
 Score = 409 (149.0 bits), Expect = 3.4e-38, P = 3.4e-38
 Identities = 81/123 (65%), Positives = 95/123 (77%)

Query:     3 IDFYYVPGSAPCRAVQLAAAQIGVPLNLKHTDLMKGEHLTPEFLKLNPQHTVPYSQQTNS 62
             +DFYY+PGSAPCRAVQ+ AA +GV LNLK TDLMKGEH+ PEFLKLNPQH VP +   N 
Sbjct:     1 MDFYYLPGSAPCRAVQMTAAAVGVELNLKLTDLMKGEHMKPEFLKLNPQHCVP-TLVDNG 59

Query:    63 QEYRREESRAIIAYLAEQYGK---DDSLYPKDPKARGIVNQRLYFDIGTLYQRFADYFVS 119
               +   ESRAI+ YL E+YGK   +DSLYP DP+ R IVNQRLYFD+GTLYQRF DY+  
Sbjct:    60 --FALWESRAIMCYLVEKYGKPCNNDSLYPTDPQKRAIVNQRLYFDMGTLYQRFGDYYYP 117

Query:   120 TLF 122
              +F
Sbjct:   118 QIF 120




GO:0004364 "glutathione transferase activity" evidence=ISS
GO:0005576 "extracellular region" evidence=ISS
GO:0006749 "glutathione metabolic process" evidence=ISS
FB|FBgn0001149 GstD1 "Glutathione S transferase D1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|O77462 GstD1 "Glutathione S-transferase 1, isoform A" [Anopheles gambiae (taxid:7165)] Back     alignment and assigned GO terms
FB|FBgn0038020 GstD9 "Glutathione S transferase D9" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0010038 GstD2 "Glutathione S transferase D2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0010044 GstD8 "Glutathione S transferase D8" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|O76483 GstD7 "Glutathione S-transferase D7" [Anopheles gambiae (taxid:7165)] Back     alignment and assigned GO terms
FB|FBgn0010041 GstD5 "Glutathione S transferase D5" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0010040 GstD4 "Glutathione S transferase D4" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0042206 GstD10 "Glutathione S transferase D10" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q93112GST1C_ANOGA4, ., 5, ., 1, ., 10.65830.92850.5598yesN/A
P20432GSTT1_DROME4, ., 5, ., 1, ., 10.5750.92850.5598yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.5.1.180.824
3rd Layer2.5.10.766

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query126
cd0304574 cd03045, GST_N_Delta_Epsilon, GST_N family, Class 2e-30
cd0305076 cd03050, GST_N_Theta, GST_N family, Class Theta su 2e-14
cd0304881 cd03048, GST_N_Ure2p_like, GST_N family, Ure2p-lik 6e-13
COG0625211 COG0625, Gst, Glutathione S-transferase [Posttrans 3e-12
cd0057071 cd00570, GST_N_family, Glutathione S-transferase ( 2e-11
cd0305673 cd03056, GST_N_4, GST_N family, unknown subfamily 3e-11
cd0305376 cd03053, GST_N_Phi, GST_N family, Class Phi subfam 3e-11
PLN02395215 PLN02395, PLN02395, glutathione S-transferase 4e-11
cd03177117 cd03177, GST_C_Delta_Epsilon, C-terminal, alpha he 3e-10
TIGR01262210 TIGR01262, maiA, maleylacetoacetate isomerase 2e-09
cd0305777 cd03057, GST_N_Beta, GST_N family, Class Beta subf 2e-08
PRK13972215 PRK13972, PRK13972, GSH-dependent disulfide bond o 4e-07
pfam1341775 pfam13417, GST_N_3, Glutathione S-transferase, N-t 1e-06
cd0304676 cd03046, GST_N_GTT1_like, GST_N family, Saccharomy 2e-06
PRK15113214 PRK15113, PRK15113, glutathione S-transferase; Pro 5e-06
cd0304273 cd03042, GST_N_Zeta, GST_N family, Class Zeta subf 8e-06
cd0304475 cd03044, GST_N_EF1Bgamma, GST_N family, Gamma subu 1e-05
cd0305174 cd03051, GST_N_GTT2_like, GST_N family, Saccharomy 2e-05
pfam0279874 pfam02798, GST_N, Glutathione S-transferase, N-ter 3e-05
pfam1340968 pfam13409, GST_N_2, Glutathione S-transferase, N-t 2e-04
PRK11752264 PRK11752, PRK11752, putative S-transferase; Provis 6e-04
>gnl|CDD|239343 cd03045, GST_N_Delta_Epsilon, GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
 Score =  103 bits (259), Expect = 2e-30
 Identities = 46/77 (59%), Positives = 52/77 (67%), Gaps = 3/77 (3%)

Query: 3  IDFYYVPGSAPCRAVQLAAAQIGVPLNLKHTDLMKGEHLTPEFLKLNPQHTVPYSQQTNS 62
          ID YY+PGS PCRAV L A  +G+ LNLK  +LMKGEHL PEFLKLNPQHTVP       
Sbjct: 1  IDLYYLPGSPPCRAVLLTAKALGLELNLKEVNLMKGEHLKPEFLKLNPQHTVP---TLVD 57

Query: 63 QEYRREESRAIIAYLAE 79
            +   ES AI+ YL E
Sbjct: 58 NGFVLWESHAILIYLVE 74


GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal TRX-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. The class Delta and Epsilon subfamily is made up primarily of insect GSTs, which play major roles in insecticide resistance by facilitating reductive dehydrochlorination of insecticides or conjugating them with GSH to produce water-soluble metabolites that are easily excreted. They are also implicated in protection against cellular damage by oxidative stress. Length = 74

>gnl|CDD|239348 cd03050, GST_N_Theta, GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase Back     alignment and domain information
>gnl|CDD|239346 cd03048, GST_N_Ure2p_like, GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs Back     alignment and domain information
>gnl|CDD|223698 COG0625, Gst, Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|238319 cd00570, GST_N_family, Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>gnl|CDD|239354 cd03056, GST_N_4, GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>gnl|CDD|239351 cd03053, GST_N_Phi, GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins Back     alignment and domain information
>gnl|CDD|166036 PLN02395, PLN02395, glutathione S-transferase Back     alignment and domain information
>gnl|CDD|198287 cd03177, GST_C_Delta_Epsilon, C-terminal, alpha helical domain of Class Delta and Epsilon Glutathione S-transferases Back     alignment and domain information
>gnl|CDD|233333 TIGR01262, maiA, maleylacetoacetate isomerase Back     alignment and domain information
>gnl|CDD|239355 cd03057, GST_N_Beta, GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>gnl|CDD|172475 PRK13972, PRK13972, GSH-dependent disulfide bond oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|205595 pfam13417, GST_N_3, Glutathione S-transferase, N-terminal domain Back     alignment and domain information
>gnl|CDD|239344 cd03046, GST_N_GTT1_like, GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>gnl|CDD|185068 PRK15113, PRK15113, glutathione S-transferase; Provisional Back     alignment and domain information
>gnl|CDD|239340 cd03042, GST_N_Zeta, GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>gnl|CDD|239342 cd03044, GST_N_EF1Bgamma, GST_N family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis Back     alignment and domain information
>gnl|CDD|239349 cd03051, GST_N_GTT2_like, GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>gnl|CDD|217234 pfam02798, GST_N, Glutathione S-transferase, N-terminal domain Back     alignment and domain information
>gnl|CDD|222110 pfam13409, GST_N_2, Glutathione S-transferase, N-terminal domain Back     alignment and domain information
>gnl|CDD|183298 PRK11752, PRK11752, putative S-transferase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 126
PLN02473214 glutathione S-transferase 99.95
PRK15113214 glutathione S-transferase; Provisional 99.95
PLN02395215 glutathione S-transferase 99.94
PRK09481211 sspA stringent starvation protein A; Provisional 99.94
KOG0867|consensus226 99.94
PRK13972215 GSH-dependent disulfide bond oxidoreductase; Provi 99.93
COG0625211 Gst Glutathione S-transferase [Posttranslational m 99.93
KOG0868|consensus217 99.93
PRK10542201 glutathionine S-transferase; Provisional 99.92
KOG0406|consensus 231 99.91
TIGR01262210 maiA maleylacetoacetate isomerase. Maleylacetoacet 99.91
PRK11752264 putative S-transferase; Provisional 99.9
PRK10357202 putative glutathione S-transferase; Provisional 99.9
cd0305273 GST_N_GDAP1 GST_N family, Ganglioside-induced diff 99.9
cd0304574 GST_N_Delta_Epsilon GST_N family, Class Delta and 99.89
cd0304881 GST_N_Ure2p_like GST_N family, Ure2p-like subfamil 99.88
cd0305076 GST_N_Theta GST_N family, Class Theta subfamily; c 99.88
PF1341775 GST_N_3: Glutathione S-transferase, N-terminal dom 99.87
cd0305376 GST_N_Phi GST_N family, Class Phi subfamily; compo 99.87
cd0305777 GST_N_Beta GST_N family, Class Beta subfamily; GST 99.86
cd0304177 GST_N_2GST_N GST_N family, 2 repeats of the N-term 99.86
cd0305673 GST_N_4 GST_N family, unknown subfamily 4; compose 99.86
cd0304773 GST_N_2 GST_N family, unknown subfamily 2; compose 99.86
cd0305174 GST_N_GTT2_like GST_N family, Saccharomyces cerevi 99.86
cd0305973 GST_N_SspA GST_N family, Stringent starvation prot 99.86
cd0304475 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elo 99.86
PF0279876 GST_N: Glutathione S-transferase, N-terminal domai 99.85
cd0304676 GST_N_GTT1_like GST_N family, Saccharomyces cerevi 99.85
cd0305874 GST_N_Tau GST_N family, Class Tau subfamily; GSTs 99.85
PRK10387210 glutaredoxin 2; Provisional 99.85
cd0304273 GST_N_Zeta GST_N family, Class Zeta subfamily; GST 99.85
cd0307673 GST_N_Pi GST_N family, Class Pi subfamily; GSTs ar 99.84
cd0306071 GST_N_Omega_like GST_N family, Omega-like subfamil 99.83
cd0306191 GST_N_CLIC GST_N family, Chloride Intracellular Ch 99.82
cd0304973 GST_N_3 GST_N family, unknown subfamily 3; compose 99.82
PLN02378213 glutathione S-transferase DHAR1 99.81
cd0303972 GST_N_Sigma_like GST_N family, Class Sigma_like; c 99.81
cd0307582 GST_N_Mu GST_N family, Class Mu subfamily; GSTs ar 99.81
TIGR02182209 GRXB Glutaredoxin, GrxB family. This model include 99.81
cd0305589 GST_N_Omega GST_N family, Class Omega subfamily; G 99.8
cd0303771 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) sub 99.8
PF1340970 GST_N_2: Glutathione S-transferase, N-terminal dom 99.79
cd0303884 GST_N_etherase_LigE GST_N family, Beta etherase Li 99.79
PLN02817265 glutathione dehydrogenase (ascorbate) 99.78
TIGR00862 236 O-ClC intracellular chloride channel protein. Thes 99.77
cd0307779 GST_N_Alpha GST_N family, Class Alpha subfamily; G 99.77
cd0308075 GST_N_Metaxin_like GST_N family, Metaxin subfamily 99.77
cd0304077 GST_N_mPGES2 GST_N family; microsomal Prostaglandi 99.76
PTZ00057205 glutathione s-transferase; Provisional 99.75
cd0304373 GST_N_1 GST_N family, unknown subfamily 1; compose 99.75
cd0057071 GST_N_family Glutathione S-transferase (GST) famil 99.72
KOG4420|consensus 325 99.71
KOG1695|consensus206 99.71
cd0305472 GST_N_Metaxin GST_N family, Metaxin subfamily; com 99.66
PLN02907 722 glutamate-tRNA ligase 99.61
COG2999 215 GrxB Glutaredoxin 2 [Posttranslational modificatio 99.52
cd0307974 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Me 99.46
TIGR0219079 GlrX-dom Glutaredoxin-family domain. This C-termin 99.26
PRK1063883 glutaredoxin 3; Provisional 99.16
KOG1422|consensus221 99.1
cd0307873 GST_N_Metaxin1_like GST_N family, Metaxin subfamil 99.06
cd0302972 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb 99.05
KOG3029|consensus 370 98.96
cd0302773 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg 98.92
PRK1032981 glutaredoxin-like protein; Provisional 98.87
cd0206672 GRX_family Glutaredoxin (GRX) family; composed of 98.83
TIGR0219674 GlrX_YruB Glutaredoxin-like protein, YruB-family. 98.83
cd0297673 NrdH NrdH-redoxin (NrdH) family; NrdH is a small m 98.81
COG069580 GrxC Glutaredoxin and related proteins [Posttransl 98.75
TIGR0220077 GlrX_actino Glutaredoxin-like protein. This family 98.71
PRK1120085 grxA glutaredoxin 1; Provisional 98.68
cd0341875 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b 98.66
TIGR0219472 GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red 98.61
TIGR0218179 GRX_bact Glutaredoxin, GrxC family. This family of 98.58
TIGR0218386 GRXA Glutaredoxin, GrxA family. This model include 98.52
KOG4244|consensus 281 98.5
cd0341982 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h 98.47
PF0046260 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl 98.41
TIGR0218999 GlrX-like_plant Glutaredoxin-like family. This fam 98.4
PHA03050108 glutaredoxin; Provisional 98.25
TIGR0218084 GRX_euk Glutaredoxin. This model represents eukary 98.21
PF1056872 Tom37: Outer mitochondrial membrane transport comp 98.07
TIGR0036597 monothiol glutaredoxin, Grx4 family. The gene for 98.06
cd0302890 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte 98.01
PRK12759 410 bifunctional gluaredoxin/ribonucleoside-diphosphat 97.64
KOG3027|consensus 257 97.49
COG1393117 ArsC Arsenate reductase and related proteins, glut 97.4
cd03031147 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like d 97.4
PRK10824115 glutaredoxin-4; Provisional 97.33
PRK01655131 spxA transcriptional regulator Spx; Reviewed 97.31
cd03032115 ArsC_Spx Arsenate Reductase (ArsC) family, Spx sub 97.31
KOG2903|consensus 319 97.3
cd03036111 ArsC_like Arsenate Reductase (ArsC) family, unknow 97.3
COG454585 Glutaredoxin-related protein [Posttranslational mo 97.28
PRK10026141 arsenate reductase; Provisional 97.23
cd02977105 ArsC_family Arsenate Reductase (ArsC) family; comp 97.2
KOG3028|consensus 313 97.15
PRK13344132 spxA transcriptional regulator Spx; Reviewed 97.09
PRK10853118 putative reductase; Provisional 97.05
PRK12559131 transcriptional regulator Spx; Provisional 97.02
PTZ00062204 glutaredoxin; Provisional 96.95
TIGR01617117 arsC_related transcriptional regulator, Spx/MgsR f 96.92
cd03033113 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD p 96.92
cd03035105 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb s 96.84
cd0297367 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- 96.8
TIGR01616126 nitro_assoc nitrogenase-associated protein. This m 96.71
KOG1752|consensus104 96.54
cd0303092 GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3 96.44
COG0435 324 ECM4 Predicted glutathione S-transferase [Posttran 96.41
cd03034112 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC s 96.33
TIGR00014114 arsC arsenate reductase (glutaredoxin). composed o 96.28
COG0278105 Glutaredoxin-related protein [Posttranslational mo 95.98
TIGR0041276 redox_disulf_2 small redox-active disulfide protei 95.94
PF0576881 DUF836: Glutaredoxin-like domain (DUF836); InterPr 95.43
PF11287112 DUF3088: Protein of unknown function (DUF3088); In 95.34
PF0490899 SH3BGR: SH3-binding, glutamic acid-rich protein; I 94.4
PF1319276 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZY 94.35
TIGR0041182 redox_disulf_1 small redox-active disulfide protei 94.29
PHA0212575 thioredoxin-like protein 93.67
PF03960110 ArsC: ArsC family; InterPro: IPR006660 Several bac 93.64
cd0165969 TRX_superfamily Thioredoxin (TRX) superfamily; a l 93.55
cd0320096 GST_C_JTV1 GST_C family, JTV-1 subfamily; composed 92.69
cd0302689 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid 92.68
PF09635122 MetRS-N: MetRS-N binding domain; InterPro: IPR0182 91.23
>PLN02473 glutathione S-transferase Back     alignment and domain information
Probab=99.95  E-value=4.6e-27  Score=163.16  Aligned_cols=110  Identities=29%  Similarity=0.353  Sum_probs=100.7

Q ss_pred             CeeEEecCCCCchHHHHHHHHHHhCCCceEEEccCCCCCCCChhHhhhCCCCccceeeeecCCCeeeechHHHHHHHHHH
Q psy2059           1 MTIDFYYVPGSAPCRAVQLAAAQIGVPLNLKHTDLMKGEHLTPEFLKLNPQHTVPYSQQTNSQEYRREESRAIIAYLAEQ   80 (126)
Q Consensus         1 M~~~Ly~~~~s~~~~~v~~~l~~~gi~~~~~~v~~~~~~~~~~~~~~~~p~~~vP~L~~~~~~~~~l~eS~aI~~yL~~~   80 (126)
                      |.||||+++.|++++||+++|+++|++|+.+.++..++++..++|+++||+|+||+|   ++||.+|+||.||++||+++
T Consensus         1 ~~~kLy~~~~s~~~~rv~~~L~e~gi~ye~~~v~~~~~~~~~~~~~~~nP~g~vP~L---~~~g~~l~ES~aI~~YL~~~   77 (214)
T PLN02473          1 MVVKVYGQIKAANPQRVLLCFLEKGIEFEVIHVDLDKLEQKKPEHLLRQPFGQVPAI---EDGDLKLFESRAIARYYATK   77 (214)
T ss_pred             CceEEecCCCCCchHHHHHHHHHcCCCceEEEecCcccccCCHHHHhhCCCCCCCeE---EECCEEEEehHHHHHHHHHH
Confidence            678999999999999999999999999999999998888899999999999999999   88999999999999999999


Q ss_pred             hCCCC-CCCCCCHHHHHHHHHHHhhhccccchhh
Q psy2059          81 YGKDD-SLYPKDPKARGIVNQRLYFDIGTLYQRF  113 (126)
Q Consensus        81 ~~~~~-~l~p~~~~~~~~~~~wl~~~~~~~~~~~  113 (126)
                      +++.+ .|+|.++.+|+++++|+.+..+.+.+..
T Consensus        78 ~~~~~~~l~p~~~~~ra~~~~~~~~~~~~~~~~~  111 (214)
T PLN02473         78 YADQGTDLLGKTLEHRAIVDQWVEVENNYFYAVA  111 (214)
T ss_pred             cCCcCCCCCCCCHHHHHHHHHHHHHHHhcccHHH
Confidence            97532 4999999999999999999888776544



>PRK15113 glutathione S-transferase; Provisional Back     alignment and domain information
>PLN02395 glutathione S-transferase Back     alignment and domain information
>PRK09481 sspA stringent starvation protein A; Provisional Back     alignment and domain information
>KOG0867|consensus Back     alignment and domain information
>PRK13972 GSH-dependent disulfide bond oxidoreductase; Provisional Back     alignment and domain information
>COG0625 Gst Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0868|consensus Back     alignment and domain information
>PRK10542 glutathionine S-transferase; Provisional Back     alignment and domain information
>KOG0406|consensus Back     alignment and domain information
>TIGR01262 maiA maleylacetoacetate isomerase Back     alignment and domain information
>PRK11752 putative S-transferase; Provisional Back     alignment and domain information
>PRK10357 putative glutathione S-transferase; Provisional Back     alignment and domain information
>cd03052 GST_N_GDAP1 GST_N family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells Back     alignment and domain information
>cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03048 GST_N_Ure2p_like GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs Back     alignment and domain information
>cd03050 GST_N_Theta GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase Back     alignment and domain information
>PF13417 GST_N_3: Glutathione S-transferase, N-terminal domain; PDB: 3ERG_B 3IBH_A 3ERF_A 3UBL_A 3UBK_A 3IR4_A 3M8N_B 2R4V_A 2PER_A 2R5G_A Back     alignment and domain information
>cd03053 GST_N_Phi GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins Back     alignment and domain information
>cd03057 GST_N_Beta GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins Back     alignment and domain information
>cd03056 GST_N_4 GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03047 GST_N_2 GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03051 GST_N_GTT2_like GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03059 GST_N_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E Back     alignment and domain information
>cd03044 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis Back     alignment and domain information
>PF02798 GST_N: Glutathione S-transferase, N-terminal domain; InterPro: IPR004045 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione Back     alignment and domain information
>cd03046 GST_N_GTT1_like GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03058 GST_N_Tau GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>PRK10387 glutaredoxin 2; Provisional Back     alignment and domain information
>cd03042 GST_N_Zeta GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03076 GST_N_Pi GST_N family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs Back     alignment and domain information
>cd03061 GST_N_CLIC GST_N family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin and similar proteins Back     alignment and domain information
>cd03049 GST_N_3 GST_N family, unknown subfamily 3; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>PLN02378 glutathione S-transferase DHAR1 Back     alignment and domain information
>cd03039 GST_N_Sigma_like GST_N family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi and Alpha Back     alignment and domain information
>cd03075 GST_N_Mu GST_N family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>TIGR02182 GRXB Glutaredoxin, GrxB family Back     alignment and domain information
>cd03055 GST_N_Omega GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03037 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E Back     alignment and domain information
>PF13409 GST_N_2: Glutathione S-transferase, N-terminal domain; PDB: 3C8E_B 3M1G_A 3R3E_A 3O3T_A 1RK4_A 1K0O_B 1K0N_A 3QR6_A 3SWL_A 3TGZ_B Back     alignment and domain information
>cd03038 GST_N_etherase_LigE GST_N family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor Back     alignment and domain information
>PLN02817 glutathione dehydrogenase (ascorbate) Back     alignment and domain information
>TIGR00862 O-ClC intracellular chloride channel protein Back     alignment and domain information
>cd03077 GST_N_Alpha GST_N family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03080 GST_N_Metaxin_like GST_N family, Metaxin subfamily, Metaxin-like proteins; a heterogenous group of proteins, predominantly uncharacterized, with similarity to metaxins and GSTs Back     alignment and domain information
>cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 Back     alignment and domain information
>PTZ00057 glutathione s-transferase; Provisional Back     alignment and domain information
>cd03043 GST_N_1 GST_N family, unknown subfamily 1; composed of uncharacterized proteins, predominantly from bacteria, with similarity to GSTs Back     alignment and domain information
>cd00570 GST_N_family Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>KOG4420|consensus Back     alignment and domain information
>KOG1695|consensus Back     alignment and domain information
>cd03054 GST_N_Metaxin GST_N family, Metaxin subfamily; composed of metaxins and related proteins Back     alignment and domain information
>PLN02907 glutamate-tRNA ligase Back     alignment and domain information
>COG2999 GrxB Glutaredoxin 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03079 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait Back     alignment and domain information
>TIGR02190 GlrX-dom Glutaredoxin-family domain Back     alignment and domain information
>PRK10638 glutaredoxin 3; Provisional Back     alignment and domain information
>KOG1422|consensus Back     alignment and domain information
>cd03078 GST_N_Metaxin1_like GST_N family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins including Tom37 from fungi Back     alignment and domain information
>cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria Back     alignment and domain information
>KOG3029|consensus Back     alignment and domain information
>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions Back     alignment and domain information
>PRK10329 glutaredoxin-like protein; Provisional Back     alignment and domain information
>cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family Back     alignment and domain information
>cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile Back     alignment and domain information
>COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02200 GlrX_actino Glutaredoxin-like protein Back     alignment and domain information
>PRK11200 grxA glutaredoxin 1; Provisional Back     alignment and domain information
>cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH Back     alignment and domain information
>TIGR02181 GRX_bact Glutaredoxin, GrxC family Back     alignment and domain information
>TIGR02183 GRXA Glutaredoxin, GrxA family Back     alignment and domain information
>KOG4244|consensus Back     alignment and domain information
>cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>TIGR02189 GlrX-like_plant Glutaredoxin-like family Back     alignment and domain information
>PHA03050 glutaredoxin; Provisional Back     alignment and domain information
>TIGR02180 GRX_euk Glutaredoxin Back     alignment and domain information
>PF10568 Tom37: Outer mitochondrial membrane transport complex protein; InterPro: IPR019564 Tom37 is one of the outer membrane proteins that make up the TOM complex for guiding cytosolic mitochondrial beta-barrel proteins from the cytosol across the outer mitochondrial membrane into the intramembrane space Back     alignment and domain information
>TIGR00365 monothiol glutaredoxin, Grx4 family Back     alignment and domain information
>cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins Back     alignment and domain information
>PRK12759 bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional Back     alignment and domain information
>KOG3027|consensus Back     alignment and domain information
>COG1393 ArsC Arsenate reductase and related proteins, glutaredoxin family [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03031 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs Back     alignment and domain information
>PRK10824 glutaredoxin-4; Provisional Back     alignment and domain information
>PRK01655 spxA transcriptional regulator Spx; Reviewed Back     alignment and domain information
>cd03032 ArsC_Spx Arsenate Reductase (ArsC) family, Spx subfamily; Spx is a unique RNA polymerase (RNAP)-binding protein present in bacilli and some mollicutes Back     alignment and domain information
>KOG2903|consensus Back     alignment and domain information
>cd03036 ArsC_like Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC Back     alignment and domain information
>COG4545 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10026 arsenate reductase; Provisional Back     alignment and domain information
>cd02977 ArsC_family Arsenate Reductase (ArsC) family; composed of TRX-fold arsenic reductases and similar proteins including the transcriptional regulator, Spx Back     alignment and domain information
>KOG3028|consensus Back     alignment and domain information
>PRK13344 spxA transcriptional regulator Spx; Reviewed Back     alignment and domain information
>PRK10853 putative reductase; Provisional Back     alignment and domain information
>PRK12559 transcriptional regulator Spx; Provisional Back     alignment and domain information
>PTZ00062 glutaredoxin; Provisional Back     alignment and domain information
>TIGR01617 arsC_related transcriptional regulator, Spx/MgsR family Back     alignment and domain information
>cd03033 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD protein subfamily; composed of proteins of unknown function with similarity to thioredoxin-fold arsenic reductases, ArsC Back     alignment and domain information
>cd03035 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb subfamily; Yffb is an uncharacterized bacterial protein encoded by the yffb gene, related to the thioredoxin-fold arsenic reductases, ArsC Back     alignment and domain information
>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) Back     alignment and domain information
>TIGR01616 nitro_assoc nitrogenase-associated protein Back     alignment and domain information
>KOG1752|consensus Back     alignment and domain information
>cd03030 GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3 domain binding glutamic acid-rich protein) subfamily; a recently-identified subfamily composed of SH3BGR and similar proteins possessing significant sequence similarity to GRX, but without a redox active CXXC motif Back     alignment and domain information
>COG0435 ECM4 Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03034 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC subfamily; arsenic reductases similar to that encoded by arsC on the R733 plasmid of Escherichia coli Back     alignment and domain information
>TIGR00014 arsC arsenate reductase (glutaredoxin) Back     alignment and domain information
>COG0278 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00412 redox_disulf_2 small redox-active disulfide protein 2 Back     alignment and domain information
>PF05768 DUF836: Glutaredoxin-like domain (DUF836); InterPro: IPR008554 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>PF11287 DUF3088: Protein of unknown function (DUF3088); InterPro: IPR021439 This family of proteins with unknown function appears to be restricted to Proteobacteria Back     alignment and domain information
>PF04908 SH3BGR: SH3-binding, glutamic acid-rich protein; InterPro: IPR006993 This family of proteins, which contains SH3BGRL3, is functionally uncharacterised Back     alignment and domain information
>PF13192 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZYN_A 1HYU_A 1ILO_A 1J08_F 2YWM_B 2AYT_B 2HLS_B 1A8L_A 2K8S_B Back     alignment and domain information
>TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 Back     alignment and domain information
>PHA02125 thioredoxin-like protein Back     alignment and domain information
>PF03960 ArsC: ArsC family; InterPro: IPR006660 Several bacterial taxon have a chromosomal resistance system, encoded by the ars operon, for the detoxification of arsenate, arsenite, and antimonite [] Back     alignment and domain information
>cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold Back     alignment and domain information
>cd03200 GST_C_JTV1 GST_C family, JTV-1 subfamily; composed of uncharacterized proteins with similarity to the translation product of the human JTV-1 gene Back     alignment and domain information
>cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides Back     alignment and domain information
>PF09635 MetRS-N: MetRS-N binding domain; InterPro: IPR018285 This entry represents the N-terminal domain of methionyl-tRNA synthetase (MetRS) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query126
1pn9_A209 Crystal Structure Of An Insect Delta-class Glutathi 1e-43
1jlv_A209 Anopheles Dirus Species B Glutathione S-transferase 3e-43
3ein_A209 Delta Class Gst Length = 209 7e-37
1jlw_A219 Anopheles Dirus Species B Glutathione S-Transferase 3e-36
3g7j_A219 Crystal Structure Of A Genetically Modified Delta C 3e-36
3f6d_A219 Crystal Structure Of A Genetically Modified Delta C 8e-36
3vk9_A216 Crystal Structure Of Delta-Class Glutathione Transf 5e-35
1r5a_A218 Glutathione S-Transferase Length = 218 4e-32
3f6f_A210 Crystal Structure Of Glutathione Transferase Dmgstd 1e-29
3ay8_A216 Glutathione S-Transferase Unclassified 2 From Bomby 9e-26
1v2a_A210 Glutathione S-transferase 1-6 From Anopheles Dirus 5e-25
2il3_A221 Structures Of An Insect Epsilon-Class Glutathione S 2e-24
3vwx_A222 Structural Analysis Of An Epsilon-class Glutathione 5e-21
4hi7_A 228 Crystal Structure Of Glutathione Transferase Homolo 6e-20
2c3n_A 247 Human Glutathione-S-Transferase T1-1, Apo Form Leng 2e-12
2c3q_A 247 Human Glutathione-S-Transferase T1-1 W234r Mutant, 2e-12
1ljr_A 244 Glutathione Transferase (Hgst T2-2) From Human Leng 6e-11
4eci_A 244 Crystal Structure Of Glutathione S-Transferase Prk1 6e-09
3qav_A243 Crystal Structure Of A Glutathione S-transferase Fr 1e-07
4iel_A229 Crystal Structure Of A Glutathione S-Transferase Fa 8e-06
3gx0_A215 Crystal Structure Of Gsh-Dependent Disulfide Bond O 7e-05
1hqo_A 258 Crystal Structure Of The Nitrogen Regulation Fragme 1e-04
1jzr_A 260 Ure2p In Complex With Glutathione Length = 260 1e-04
1g6w_A 261 Crystal Structure Of The Globular Region Of The Pri 1e-04
1gnw_A211 Structure Of Glutathione S-Transferase Length = 211 4e-04
3m8n_A 225 Crystal Structure Of A Possible Gutathione S-Tranfe 6e-04
3m3m_A210 Crystal Structure Of Glutathione S-Transferase From 8e-04
>pdb|1PN9|A Chain A, Crystal Structure Of An Insect Delta-class Glutathione S- Transferase From A Ddt-resistant Strain Of The Malaria Vector Anopheles Gambiae Length = 209 Back     alignment and structure

Iteration: 1

Score = 171 bits (433), Expect = 1e-43, Method: Compositional matrix adjust. Identities = 81/120 (67%), Positives = 93/120 (77%), Gaps = 3/120 (2%) Query: 3 IDFYYVPGSAPCRAVQLAAAQIGVPLNLKHTDLMKGEHLTPEFLKLNPQHTVPYSQQTNS 62 +DFYY+PGSAPCRAVQ+ AA +GV LNLK TDLMKGEH+ PEFLKLNPQH +P Sbjct: 1 MDFYYLPGSAPCRAVQMTAAAVGVELNLKLTDLMKGEHMKPEFLKLNPQHCIP---TLVD 57 Query: 63 QEYRREESRAIIAYLAEQYGKDDSLYPKDPKARGIVNQRLYFDIGTLYQRFADYFVSTLF 122 + ESRAI YLAE+YGKDD LYPKDP+ R +VNQRLYFD+GTLYQRFADY +F Sbjct: 58 NGFALWESRAIQIYLAEKYGKDDKLYPKDPQKRAVVNQRLYFDMGTLYQRFADYHYPQIF 117
>pdb|1JLV|A Chain A, Anopheles Dirus Species B Glutathione S-transferases 1-3 Length = 209 Back     alignment and structure
>pdb|3EIN|A Chain A, Delta Class Gst Length = 209 Back     alignment and structure
>pdb|1JLW|A Chain A, Anopheles Dirus Species B Glutathione S-Transferases 1-4 Length = 219 Back     alignment and structure
>pdb|3G7J|A Chain A, Crystal Structure Of A Genetically Modified Delta Class Gst (adgstd4- 4) From Anopheles Dirus, Y119e, In Complex With S-hexyl Glutathione Length = 219 Back     alignment and structure
>pdb|3F6D|A Chain A, Crystal Structure Of A Genetically Modified Delta Class Gst (Adgstd4- 4) From Anopheles Dirus, F123a, In Complex With S-Hexyl Glutathione Length = 219 Back     alignment and structure
>pdb|3VK9|A Chain A, Crystal Structure Of Delta-Class Glutathione Transferase From Silkmoth Length = 216 Back     alignment and structure
>pdb|1R5A|A Chain A, Glutathione S-Transferase Length = 218 Back     alignment and structure
>pdb|3F6F|A Chain A, Crystal Structure Of Glutathione Transferase Dmgstd10 From Drosophila Melanogaster Length = 210 Back     alignment and structure
>pdb|3AY8|A Chain A, Glutathione S-Transferase Unclassified 2 From Bombyx Mori Length = 216 Back     alignment and structure
>pdb|1V2A|A Chain A, Glutathione S-transferase 1-6 From Anopheles Dirus Species B Length = 210 Back     alignment and structure
>pdb|2IL3|A Chain A, Structures Of An Insect Epsilon-Class Glutathione S- Transferase From The Malaria Vector Anopheles Gambiae: Evidence For High Ddt-Detoxifying Activity Length = 221 Back     alignment and structure
>pdb|3VWX|A Chain A, Structural Analysis Of An Epsilon-class Glutathione S-transferase From Housefly, Musca Domestica Length = 222 Back     alignment and structure
>pdb|4HI7|A Chain A, Crystal Structure Of Glutathione Transferase Homolog From Drosophilia Mojavensis, Target Efi-501819, With Bound Glutathione Length = 228 Back     alignment and structure
>pdb|2C3N|A Chain A, Human Glutathione-S-Transferase T1-1, Apo Form Length = 247 Back     alignment and structure
>pdb|2C3Q|A Chain A, Human Glutathione-S-Transferase T1-1 W234r Mutant, Complex With S-Hexylglutathione Length = 247 Back     alignment and structure
>pdb|1LJR|A Chain A, Glutathione Transferase (Hgst T2-2) From Human Length = 244 Back     alignment and structure
>pdb|4ECI|A Chain A, Crystal Structure Of Glutathione S-Transferase Prk13972 (Target Efi- 501853) From Pseudomonas Aeruginosa Pacs2 Complexed With Acetate Length = 244 Back     alignment and structure
>pdb|3QAV|A Chain A, Crystal Structure Of A Glutathione S-transferase From Antarctic Clam Laternula Elliptica Length = 243 Back     alignment and structure
>pdb|4IEL|A Chain A, Crystal Structure Of A Glutathione S-Transferase Family Protein From Burkholderia Ambifaria, Target Efi-507141, With Bound Glutathione Length = 229 Back     alignment and structure
>pdb|3GX0|A Chain A, Crystal Structure Of Gsh-Dependent Disulfide Bond Oxidoreductase Length = 215 Back     alignment and structure
>pdb|1HQO|A Chain A, Crystal Structure Of The Nitrogen Regulation Fragment Of The Yeast Prion Protein Ure2p Length = 258 Back     alignment and structure
>pdb|1JZR|A Chain A, Ure2p In Complex With Glutathione Length = 260 Back     alignment and structure
>pdb|1G6W|A Chain A, Crystal Structure Of The Globular Region Of The Prion Protein Ure2 From The Yeast Saccaromyces Cerevisiae Length = 261 Back     alignment and structure
>pdb|1GNW|A Chain A, Structure Of Glutathione S-Transferase Length = 211 Back     alignment and structure
>pdb|3M8N|A Chain A, Crystal Structure Of A Possible Gutathione S-Tranferase From Rhodopseudomonas Palustris Length = 225 Back     alignment and structure
>pdb|3M3M|A Chain A, Crystal Structure Of Glutathione S-Transferase From Pseudomonas Fluorescens [pf-5] Length = 210 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query126
1r5a_A218 Glutathione transferase; glutathione S-transferase 6e-54
3ein_A209 GST class-theta, glutathione S-transferase 1-1; de 2e-53
1pn9_A209 GST class-delta, glutathione S-transferase 1-6; pr 2e-53
3ay8_A216 Glutathione S-transferase; GST fold, GST binding, 4e-52
2imi_A221 Epsilon-class glutathione S-transferase; HET: GSH; 8e-52
3f6d_A219 Adgstd4-4, glutathione transferase GST1-4; HET: GT 4e-51
1ljr_A 244 HGST T2-2, glutathione S-transferase; HET: GSH; 3. 3e-50
1v2a_A210 Glutathione transferase GST1-6; glutathione S-tran 4e-49
2c3n_A 247 Glutathione S-transferase theta 1; glutathione tra 1e-48
3qav_A243 RHO-class glutathione S-transferase; cytosol; 2.10 1e-38
1axd_A209 Glutathione S-transferase I; transferase, herbicid 1e-36
1gnw_A211 Glutathione S-transferase; herbicide detoxificatio 3e-34
1e6b_A221 Glutathione S-transferase; 1.65A {Arabidopsis thal 5e-33
3ibh_A233 GST-II, saccharomyces cerevisiae GTT2; glutathione 2e-29
2v6k_A214 Maleylpyruvate isomerase; glutathione-S-transferas 4e-28
2cz2_A223 Maleylacetoacetate isomerase; structural genomics, 2e-27
3bby_A215 Uncharacterized GST-like protein YFCF; NP_416804.1 1e-26
1aw9_A216 Glutathione S-transferase III; herbicide detoxific 2e-26
3m8n_A 225 Possible glutathione S-transferase; PSI-II, struct 1e-24
3n5o_A235 Glutathione transferase; seattle structural genomi 7e-24
4exj_A 238 Uncharacterized protein; transferase-like protein, 2e-23
3niv_A222 Glutathione S-transferase; structural genomics, PS 7e-20
1n2a_A201 Glutathione S-transferase; HET: GTS; 1.90A {Escher 2e-19
4g9h_A211 Glutathione S-transferase; GST, enzyme function in 3e-19
2dsa_A203 Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu 2e-18
1pmt_A203 PMGST, GST B1-1, glutathione transferase; glutathi 9e-18
3m3m_A210 Glutathione S-transferase; PSI-II, structural geno 2e-17
1nhy_A219 EF-1-gamma 1, elongation factor 1-gamma 1; protein 4e-17
3uar_A 227 Glutathione S-transferase; GSH binding site; HET: 1e-16
3lsz_A225 Glutathione S-transferase; xenobiotic, biodegradat 4e-15
1f2e_A201 Glutathione S-transferase; GST complexed with glut 7e-15
3m0f_A213 Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu 1e-14
3ubk_A 242 Glutathione transferase; GSH binding; 1.95A {Lepto 3e-14
3lxz_A 229 Glutathione S-transferase family protein; structur 3e-14
3gx0_A215 GST-like protein YFCG; transferase, glutathione, g 3e-14
2pvq_A201 Glutathione S-transferase; xenobiotics detoxificat 1e-13
2x64_A207 Glutathione-S-transferase; detoxification enzyme; 1e-13
1k0d_A 260 URE2 protein; nitrate assimilation, structural gen 3e-13
2ycd_A230 Glutathione S-transferase; SOIL bacteria, herbicid 4e-13
3c8e_A 288 YGHU, glutathione S-transferase homologue; glutath 6e-13
4ecj_A 244 Glutathione S-transferase; transferase-like protei 8e-13
2uz8_A174 Eukaryotic translation elongation factor 1 epsilon 9e-11
3tou_A 226 Glutathione S-transferase protein; GSH binding sit 9e-11
3lyp_A215 Stringent starvation protein A; structural genomic 1e-09
1yy7_A213 SSPA, stringent starvation protein A; GST fold, tr 2e-08
3r2q_A202 Uncharacterized GST-like protein YIBF; transferase 5e-08
3cbu_A214 Probable GST-related protein; thioredoxin fold, GS 1e-07
3lyk_A216 Stringent starvation protein A homolog; structural 1e-07
2fno_A 248 AGR_PAT_752P; thioredoxin fold, GST C-terminal dom 2e-07
4dej_A 231 Glutathione S-transferase related protein; transfe 8e-07
3vln_A241 GSTO-1, glutathione S-transferase omega-1; GST fol 2e-06
3q18_A239 GSTO-2, glutathione S-transferase omega-2; glutath 3e-06
3rbt_A246 Glutathione transferase O1; glutathione S-transfer 3e-06
2vo4_A219 2,4-D inducible glutathione S-transferase; herbici 5e-06
2yv7_A 260 CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c 2e-05
4ags_A 471 Thiol-dependent reductase 1; transferase, leishman 3e-05
4ags_A 471 Thiol-dependent reductase 1; transferase, leishman 1e-04
3fy7_A250 Chloride intracellular channel protein 3; GST, glu 6e-05
1k0m_A 241 CLIC1, NCC27, chloride intracellular channel prote 7e-05
2ahe_A 267 Chloride intracellular channel protein 4; glutathi 2e-04
1gwc_A 230 Glutathione S-transferase TSI-1; herbicide detoxif 2e-04
2r4v_A 247 XAP121, chloride intracellular channel protein 2; 3e-04
>1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 Length = 218 Back     alignment and structure
 Score =  167 bits (425), Expect = 6e-54
 Identities = 62/122 (50%), Positives = 83/122 (68%), Gaps = 3/122 (2%)

Query: 1   MTIDFYYVPGSAPCRAVQLAAAQIGVPLNLKHTDLMKGEHLTPEFLKLNPQHTVPYSQQT 60
           MT   YY+P S PCR+V L A  IGV L+LK  ++M+GE L P+F++LNPQH +P     
Sbjct: 1   MTTVLYYLPASPPCRSVLLLAKMIGVELDLKVLNIMEGEQLKPDFVELNPQHCIPTMD-- 58

Query: 61  NSQEYRREESRAIIAYLAEQYGKDDSLYPKDPKARGIVNQRLYFDIGTLYQRFADYFVST 120
                   ESR I++YL   YGKD++LYPKD ++R IV+QRL+FD+GTLYQR  DY+  T
Sbjct: 59  -DHGLVLWESRVILSYLVSAYGKDENLYPKDFRSRAIVDQRLHFDLGTLYQRVVDYYFPT 117

Query: 121 LF 122
           + 
Sbjct: 118 IH 119


>3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* Length = 209 Back     alignment and structure
>1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 Length = 209 Back     alignment and structure
>3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} Length = 216 Back     alignment and structure
>2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* Length = 221 Back     alignment and structure
>3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* Length = 219 Back     alignment and structure
>1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* Length = 244 Back     alignment and structure
>1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 Length = 210 Back     alignment and structure
>2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A Length = 247 Back     alignment and structure
>3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* Length = 243 Back     alignment and structure
>1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* Length = 209 Back     alignment and structure
>1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* Length = 211 Back     alignment and structure
>1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 Length = 221 Back     alignment and structure
>3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* Length = 233 Back     alignment and structure
>2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* Length = 214 Back     alignment and structure
>2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Length = 223 Back     alignment and structure
>3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} Length = 215 Back     alignment and structure
>1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 Length = 216 Back     alignment and structure
>3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} Length = 225 Back     alignment and structure
>3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* Length = 235 Back     alignment and structure
>4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} Length = 238 Back     alignment and structure
>3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} Length = 222 Back     alignment and structure
>1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* Length = 201 Back     alignment and structure
>4g9h_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 2.10A {Yersinia pestis} Length = 211 Back     alignment and structure
>2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* Length = 203 Back     alignment and structure
>1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* Length = 203 Back     alignment and structure
>3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} Length = 210 Back     alignment and structure
>1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 Length = 219 Back     alignment and structure
>3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* Length = 227 Back     alignment and structure
>3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} Length = 225 Back     alignment and structure
>1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 Length = 201 Back     alignment and structure
>3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* Length = 213 Back     alignment and structure
>3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* Length = 242 Back     alignment and structure
>3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* Length = 229 Back     alignment and structure
>3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} Length = 215 Back     alignment and structure
>2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* Length = 201 Back     alignment and structure
>2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} Length = 207 Back     alignment and structure
>1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A Length = 260 Back     alignment and structure
>2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A Length = 230 Back     alignment and structure
>3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} Length = 288 Back     alignment and structure
>4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A* Length = 244 Back     alignment and structure
>2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens} Length = 174 Back     alignment and structure
>3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* Length = 226 Back     alignment and structure
>3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A Length = 215 Back     alignment and structure
>1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} Length = 213 Back     alignment and structure
>3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} Length = 202 Back     alignment and structure
>3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} Length = 214 Back     alignment and structure
>3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} Length = 216 Back     alignment and structure
>2fno_A AGR_PAT_752P; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics, JCSG; 2.00A {Agrobacterium tumefaciens} SCOP: a.45.1.1 c.47.1.5 Length = 248 Back     alignment and structure
>4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} Length = 231 Back     alignment and structure
>3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* Length = 241 Back     alignment and structure
>3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* Length = 239 Back     alignment and structure
>3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} Length = 246 Back     alignment and structure
>2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* Length = 219 Back     alignment and structure
>2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} Length = 260 Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Length = 471 Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Length = 471 Back     alignment and structure
>3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A Length = 250 Back     alignment and structure
>1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A Length = 241 Back     alignment and structure
>2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Length = 267 Back     alignment and structure
>1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 Length = 230 Back     alignment and structure
>2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* Length = 247 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query126
3vk9_A216 Glutathione S-transferase delta; glutathione bindi 100.0
4hi7_A 228 GI20122; GST, glutathione S-transferase, enzyme fu 99.97
4glt_A225 Glutathione S-transferase-like protein; structural 99.97
4gf0_A215 Glutathione S-transferase; GST, enzyme function in 99.97
1r5a_A218 Glutathione transferase; glutathione S-transferase 99.97
3ay8_A216 Glutathione S-transferase; GST fold, GST binding, 99.96
4hoj_A210 REGF protein; GST, glutathione S-transferase, enzy 99.96
2imi_A221 Epsilon-class glutathione S-transferase; HET: GSH; 99.96
3ein_A209 GST class-theta, glutathione S-transferase 1-1; de 99.96
3niv_A222 Glutathione S-transferase; structural genomics, PS 99.96
4id0_A214 Glutathione S-transferase-like protein YIBF; GST, 99.96
1ljr_A 244 HGST T2-2, glutathione S-transferase; HET: GSH; 3. 99.96
1pn9_A209 GST class-delta, glutathione S-transferase 1-6; pr 99.96
3f6d_A219 Adgstd4-4, glutathione transferase GST1-4; HET: GT 99.96
1gnw_A211 Glutathione S-transferase; herbicide detoxificatio 99.96
4iel_A229 Glutathione S-transferase, N-terminal domain PROT; 99.95
3m0f_A213 Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu 99.95
1axd_A209 Glutathione S-transferase I; transferase, herbicid 99.95
1v2a_A210 Glutathione transferase GST1-6; glutathione S-tran 99.95
4gci_A211 Glutathione S-transferase; GST, enzyme function in 99.95
3ibh_A233 GST-II, saccharomyces cerevisiae GTT2; glutathione 99.95
3lsz_A225 Glutathione S-transferase; xenobiotic, biodegradat 99.95
3bby_A215 Uncharacterized GST-like protein YFCF; NP_416804.1 99.95
3lxz_A 229 Glutathione S-transferase family protein; structur 99.95
3tou_A 226 Glutathione S-transferase protein; GSH binding sit 99.95
2v6k_A214 Maleylpyruvate isomerase; glutathione-S-transferas 99.95
1e6b_A221 Glutathione S-transferase; 1.65A {Arabidopsis thal 99.95
1aw9_A216 Glutathione S-transferase III; herbicide detoxific 99.95
3m3m_A210 Glutathione S-transferase; PSI-II, structural geno 99.95
4hz2_A230 Glutathione S-transferase domain; glutathione,enzy 99.95
1k0d_A 260 URE2 protein; nitrate assimilation, structural gen 99.95
2c3n_A 247 Glutathione S-transferase theta 1; glutathione tra 99.95
1yy7_A213 SSPA, stringent starvation protein A; GST fold, tr 99.95
3r2q_A202 Uncharacterized GST-like protein YIBF; transferase 99.95
4hz4_A217 Glutathione-S-transferase; enzyme function initiat 99.95
3m8n_A 225 Possible glutathione S-transferase; PSI-II, struct 99.94
2cz2_A223 Maleylacetoacetate isomerase; structural genomics, 99.94
3uar_A 227 Glutathione S-transferase; GSH binding site; HET: 99.94
3gx0_A215 GST-like protein YFCG; transferase, glutathione, g 99.94
3lyk_A216 Stringent starvation protein A homolog; structural 99.94
3n5o_A235 Glutathione transferase; seattle structural genomi 99.94
3qav_A243 RHO-class glutathione S-transferase; cytosol; 2.10 99.94
3lyp_A215 Stringent starvation protein A; structural genomic 99.94
4dej_A 231 Glutathione S-transferase related protein; transfe 99.94
2vo4_A219 2,4-D inducible glutathione S-transferase; herbici 99.94
4ikh_A244 Glutathione S-transferase; enzyme function initiat 99.94
4ecj_A 244 Glutathione S-transferase; transferase-like protei 99.94
3ubk_A 242 Glutathione transferase; GSH binding; 1.95A {Lepto 99.94
4g10_A 265 Glutathione S-transferase homolog; thioredoxin fol 99.94
1yq1_A208 Glutathione S-transferase; nematoda, structural ge 99.94
1oyj_A231 Glutathione S-transferase; herbicide detoxificatio 99.94
1n2a_A201 Glutathione S-transferase; HET: GTS; 1.90A {Escher 99.94
1gwc_A 230 Glutathione S-transferase TSI-1; herbicide detoxif 99.94
2x64_A207 Glutathione-S-transferase; detoxification enzyme; 99.93
4exj_A 238 Uncharacterized protein; transferase-like protein, 99.93
2ycd_A230 Glutathione S-transferase; SOIL bacteria, herbicid 99.93
2ws2_A204 NU-class GST, glutathione S-transferase; parasite, 99.93
1f2e_A201 Glutathione S-transferase; GST complexed with glut 99.93
2dsa_A203 Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu 99.93
1zl9_A207 GST class-sigma, glutathione S-transferase 5; glut 99.93
2on5_A206 Nagst-2, Na glutathione S-transferase 2; hookworm; 99.93
2pvq_A201 Glutathione S-transferase; xenobiotics detoxificat 99.93
3q18_A239 GSTO-2, glutathione S-transferase omega-2; glutath 99.93
3cbu_A214 Probable GST-related protein; thioredoxin fold, GS 99.93
1pmt_A203 PMGST, GST B1-1, glutathione transferase; glutathi 99.93
1nhy_A219 EF-1-gamma 1, elongation factor 1-gamma 1; protein 99.93
2on7_A206 Nagst-1, Na glutathione S-transferase 1; hookworm; 99.93
3rbt_A246 Glutathione transferase O1; glutathione S-transfer 99.93
3vln_A 241 GSTO-1, glutathione S-transferase omega-1; GST fol 99.93
1tw9_A206 Glutathione S-transferase 2; 1.71A {Heligmosomoide 99.92
1tu7_A208 Glutathione S-transferase 2; HET: GSH; 1.50A {Onch 99.92
2hnl_A225 Glutathione S-transferase 1; prostaglandin synthas 99.92
2gsq_A202 Squid GST, glutathione S-transferase; squid digest 99.92
2a2r_A210 Glutathione S-transferase P; detoxification, nitri 99.92
1m0u_A249 GST2 gene product; flight muscle protein, sigma, t 99.92
3iso_A218 Putative glutathione transferase; GST; HET: GSH; 1 99.92
2wb9_A211 Glutathione transferase sigma class; thioredoxin f 99.92
1okt_A211 Glutathione S-transferase; GST; 1.9A {Plasmodium f 99.91
2cvd_A198 Glutathione-requiring prostaglandin D synthase; gl 99.91
2c4j_A218 Glutathione S-transferase MU 2; glutathione transf 99.91
3c8e_A 288 YGHU, glutathione S-transferase homologue; glutath 99.91
1gsu_A219 GST, CGSTM1-1, class-MU glutathione S-transferase; 99.9
3h1n_A 252 Probable glutathione S-transferase; APC84167, bord 99.9
3ic8_A 310 Uncharacterized GST-like proteinprotein; glutathio 99.9
1k3y_A 221 GSTA1-1, glutathione S-transferase A1; S-hexyl glu 99.9
4ags_A 471 Thiol-dependent reductase 1; transferase, leishman 99.9
4f03_A 253 Glutathione transferase; GST fold; 1.80A {Phaneroc 99.9
1b48_A 221 GST, mgsta4-4, protein (glutathione S-transferase) 99.89
3gtu_B224 Glutathione S-transferase; conjugation, detoxifica 99.89
1oe8_A211 Glutathione S-transferase; schistosomiasis, detoxi 99.89
1vf1_A 229 Glutathione S-transferase 3; detoxification; HET: 99.89
1k0m_A 241 CLIC1, NCC27, chloride intracellular channel prote 99.89
3ir4_A 218 Glutaredoxin 2; glutathione, IDP00895, structural 99.89
3ik7_A 222 Glutathione S-transferase A4; human GST A4-4, enzy 99.88
4ags_A471 Thiol-dependent reductase 1; transferase, leishman 99.88
2r4v_A 247 XAP121, chloride intracellular channel protein 2; 99.88
2fhe_A216 GST, glutathione S-transferase; transferase-substr 99.87
2ahe_A 267 Chloride intracellular channel protein 4; glutathi 99.87
1bg5_A 254 MAB, fusion protein of alpha-Na,K-ATPase with glut 99.87
2fno_A 248 AGR_PAT_752P; thioredoxin fold, GST C-terminal dom 99.87
1dug_A 234 Chimera of glutathione S-transferase-synthetic lin 99.87
1b8x_A 280 Protein (AML-1B); nuclear matrix targeting signal 99.87
1z9h_A 290 Membrane-associated prostaglandin E synthase-2; me 99.83
2yv7_A 260 CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c 99.8
3fy7_A250 Chloride intracellular channel protein 3; GST, glu 99.77
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 99.77
3m1g_A 362 Putative glutathione S-transferase; ECM4-like subf 99.77
2yv9_A 291 Chloride intracellular channel EXC-4; chloride ION 99.76
3ppu_A 352 Glutathione-S-transferase; GST fold; HET: GSH; 2.3 99.76
2hsn_A160 Methionyl-tRNA synthetase, cytoplasmic; protein co 99.66
2uz8_A174 Eukaryotic translation elongation factor 1 epsilon 99.59
2hra_A209 Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, l 99.48
3msz_A89 Glutaredoxin 1; alpha-beta sandwich, center for st 99.42
4fqu_A 313 Putative glutathione transferase; glutathionyl-hyd 99.42
4g0i_A 328 Protein YQJG; glutathionyl-hydroquinone reductase, 99.37
1fov_A82 Glutaredoxin 3, GRX3; active site disulfide, CIS P 99.3
2klx_A89 Glutaredoxin; thioredoxin type domain, ssgcid, ele 99.18
2khp_A92 Glutaredoxin; thioredoxin type domain, ssgcid, ele 99.18
3ic4_A92 Glutaredoxin (GRX-1); structural genomics, PSI, MC 99.08
2lqo_A92 Putative glutaredoxin RV3198.1/MT3292; TRX fold, o 99.05
1nm3_A241 Protein HI0572; hybrid, peroxiredoxin, glutaredoxi 98.98
1r7h_A75 NRDH-redoxin; thioredoxin, glutaredoxin, redox pro 98.92
3qmx_A99 Glutaredoxin A, glutaredoxin 3; electron transport 98.88
1aba_A87 Glutaredoxin; electron transport; HET: MES; 1.45A 98.87
1t1v_A93 SH3BGRL3, SH3 domain-binding glutamic acid-rich pr 98.67
1ego_A85 Glutaredoxin; electron transport; NMR {Escherichia 98.6
3nzn_A103 Glutaredoxin; structural genomics, PSI2, MCSG, pro 98.56
3rhb_A113 ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox 98.53
2ct6_A111 SH3 domain-binding glutamic acid-rich-like protein 98.52
3h8q_A114 Thioredoxin reductase 3; oxidoreductase, structura 98.49
1h75_A81 Glutaredoxin-like protein NRDH; electron transport 98.49
2cq9_A130 GLRX2 protein, glutaredoxin 2; glutathione-S-trans 98.44
1wik_A109 Thioredoxin-like protein 2; picot homology 2 domai 98.34
2ht9_A146 Glutaredoxin-2; thioredoxin fold, iron-sulfur clus 98.33
3zyw_A111 Glutaredoxin-3; metal binding protein; 1.84A {Homo 98.31
1kte_A105 Thioltransferase; redox-active center, electron tr 98.31
3ctg_A129 Glutaredoxin-2; reduced form, electron transport, 98.25
3ipz_A109 Monothiol glutaredoxin-S14, chloroplastic; electro 98.21
2yan_A105 Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H 98.18
2wci_A135 Glutaredoxin-4; redox-active center, iron-sulfur c 98.16
3c1r_A118 Glutaredoxin-1; oxidized form, oxidoreductase, cyt 98.16
2kok_A120 Arsenate reductase; brucellosis, zoonotic, oxidore 98.15
3l4n_A127 Monothiol glutaredoxin-6; C-terminal domain of GRX 98.12
2hze_A114 Glutaredoxin-1; thioredoxin fold, arsenic, dimethy 98.08
3gx8_A121 Monothiol glutaredoxin-5, mitochondrial; TRX fold, 98.03
2wem_A118 Glutaredoxin-related protein 5; chromosome 14 open 98.01
1u6t_A121 SH3 domain-binding glutamic acid-rich-like protein 97.96
1ttz_A87 Conserved hypothetical protein; structural genomic 97.91
3gkx_A120 Putative ARSC family related protein; ARSC family 97.85
1z3e_A132 Regulatory protein SPX; bacterial transcription re 97.79
3fz4_A120 Putative arsenate reductase; APC61768, structural 97.78
3f0i_A119 Arsenate reductase; structural genomics, IDP01300, 97.78
1rw1_A114 Conserved hypothetical protein YFFB; thioredoxin f 97.56
3rdw_A121 Putative arsenate reductase; structural genomics, 97.53
1s3c_A141 Arsenate reductase; ARSC, arsenite, oxidoreductase 97.51
2fgx_A107 Putative thioredoxin; NET3, NESG, GFT-glutaredoxin 97.49
3l78_A120 Regulatory protein SPX; transcription, transcripti 97.43
2x8g_A 598 Thioredoxin glutathione reductase; redox-active ce 97.21
2jad_A362 Yellow fluorescent protein glutaredoxin fusion pro 97.16
2wul_A118 Glutaredoxin related protein 5; chromosome 14 open 97.15
2k8s_A80 Thioredoxin; dimer, structural genomics, PSI-2, pr 97.1
2e7p_A116 Glutaredoxin; thioredoxin fold, poplar, electron t 97.08
1wjk_A100 C330018D20RIK protein; glutaredoxin, thioredoxin f 96.92
2axo_A270 Hypothetical protein ATU2684; alpha beta protein., 93.56
1nho_A85 Probable thioredoxin; beta sheet, alpha helix, oxi 91.19
3kp8_A106 Vkorc1/thioredoxin domain protein; blood coagulati 88.51
1fo5_A85 Thioredoxin; disulfide oxidoreductase, structural 88.49
1ilo_A77 Conserved hypothetical protein MTH895; beta-alpha- 85.16
2hqt_A124 GU4 nucleic-binding protein 1; GST-fold, biosynthe 82.45
2hls_A243 Protein disulfide oxidoreductase; thioredoxin fold 80.35
>3vk9_A Glutathione S-transferase delta; glutathione binding; 2.00A {Bombyx mori} Back     alignment and structure
Probab=100.00  E-value=2.1e-32  Score=188.76  Aligned_cols=119  Identities=65%  Similarity=1.064  Sum_probs=112.6

Q ss_pred             CeeEEecCCCCchHHHHHHHHHHhCCCceEEEccCCCCCCCChhHhhhCCCCccceeeeecCCCeeeechHHHHHHHHHH
Q psy2059           1 MTIDFYYVPGSAPCRAVQLAAAQIGVPLNLKHTDLMKGEHLTPEFLKLNPQHTVPYSQQTNSQEYRREESRAIIAYLAEQ   80 (126)
Q Consensus         1 M~~~Ly~~~~s~~~~~v~~~l~~~gi~~~~~~v~~~~~~~~~~~~~~~~p~~~vP~L~~~~~~~~~l~eS~aI~~yL~~~   80 (126)
                      |+|+||+++.||+|++||++|+++|++|+.+.|++..++++.++|+++||.|+||+|   ++||.+|+||.||++||+++
T Consensus         1 M~mkLY~~~~S~~~~~v~~~l~~~gi~~e~~~v~~~~~~~~~~~~~~~nP~g~vP~L---~d~g~~l~eS~aI~~YL~~~   77 (216)
T 3vk9_A            1 MTIDLYYVPGSAPCRAVLLTAKALNLNLNLKLVDLHHGEQLKPEYLKLNPQHTVPTL---VDDGLSIWESRAIITYLVNK   77 (216)
T ss_dssp             CCCEEEECTTCHHHHHHHHHHHHHTCCCEEEECCGGGTGGGSHHHHHHCTTCCSCEE---EETTEEECCHHHHHHHHHHH
T ss_pred             CCEEEEeCCCChhHHHHHHHHHHcCCCCEEEEeCCCCCccCCHHHHHhCCCCccceE---ecCCceeechHHHHHHHHHh
Confidence            899999999999999999999999999999999999989999999999999999999   89999999999999999999


Q ss_pred             hCCCCCCCCCCHHHHHHHHHHHhhhccccchhhHHHHHHHHH
Q psy2059          81 YGKDDSLYPKDPKARGIVNQRLYFDIGTLYQRFADYFVSTLF  122 (126)
Q Consensus        81 ~~~~~~l~p~~~~~~~~~~~wl~~~~~~~~~~~~~~~~~~~~  122 (126)
                      |+.+..++|.++.+++.+++|+.+..+.+.+.+...+++..+
T Consensus        78 ~~~~~~l~p~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~  119 (216)
T 3vk9_A           78 YAKGSSLYPEDPKARALVDQRLYFDIGTLYQRFSDYFYPQVF  119 (216)
T ss_dssp             HCTTCTTSCCSHHHHHHHHHHHHHHHHTHHHHHHHHHHHHHH
T ss_pred             cCcccCCCCCCHHHHHHhhhhHHHHhhhhhhHHHHHHHHHHH
Confidence            997666999999999999999999999999998888877654



>4hi7_A GI20122; GST, glutathione S-transferase, enzyme function initiative, structural genomics, unknown function; HET: GSH; 1.25A {Drosophila mojavensis} Back     alignment and structure
>4glt_A Glutathione S-transferase-like protein; structural genomics, function initiative, EFI; HET: GSH; 2.20A {Methylobacillus flagellatus} Back     alignment and structure
>4gf0_A Glutathione S-transferase; GST, enzyme function initiative, EFI, structural genomics; HET: GSH; 1.75A {Sulfitobacter} Back     alignment and structure
>1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} Back     alignment and structure
>4hoj_A REGF protein; GST, glutathione S-transferase, enzyme function initiative, structural genomics, transferase; HET: GSH; 1.40A {Neisseria gonorrhoeae} Back     alignment and structure
>2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* Back     alignment and structure
>3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* Back     alignment and structure
>3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} Back     alignment and structure
>4id0_A Glutathione S-transferase-like protein YIBF; GST, enzyme function initiative, structural genomics; HET: GSF; 1.10A {Pseudomonas fluorescens} PDB: 4ibp_A* Back     alignment and structure
>1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* Back     alignment and structure
>1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* Back     alignment and structure
>1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* Back     alignment and structure
>4iel_A Glutathione S-transferase, N-terminal domain PROT; GST, glutathione S-transferase, enzyme function initiative, structural genomics; HET: GSH; 1.60A {Burkholderia ambifaria} Back     alignment and structure
>3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* Back     alignment and structure
>1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* Back     alignment and structure
>1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4gci_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 1.50A {Yersinia pestis} PDB: 4g9h_A* Back     alignment and structure
>3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* Back     alignment and structure
>3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} Back     alignment and structure
>3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} Back     alignment and structure
>3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* Back     alignment and structure
>3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* Back     alignment and structure
>2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* Back     alignment and structure
>1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} Back     alignment and structure
>4hz2_A Glutathione S-transferase domain; glutathione,enzyme function initiative; HET: GSH; 1.50A {Xanthobacter autotrophicus} Back     alignment and structure
>1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A Back     alignment and structure
>2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A Back     alignment and structure
>1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} Back     alignment and structure
>3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} Back     alignment and structure
>4hz4_A Glutathione-S-transferase; enzyme function initiative; 1.62A {Actinobacillus pleuropneumoniae} Back     alignment and structure
>3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} Back     alignment and structure
>2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Back     alignment and structure
>3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* Back     alignment and structure
>3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} Back     alignment and structure
>3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} Back     alignment and structure
>3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* Back     alignment and structure
>3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* Back     alignment and structure
>3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A Back     alignment and structure
>4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} Back     alignment and structure
>2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* Back     alignment and structure
>4ikh_A Glutathione S-transferase; enzyme function initiative, EFI, structural genomics; HET: GSH; 2.10A {Pseudomonas protegens} Back     alignment and structure
>4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A* Back     alignment and structure
>3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* Back     alignment and structure
>4g10_A Glutathione S-transferase homolog; thioredoxin fold; HET: MSE GSH; 1.20A {Sphingomonas paucimobilis} Back     alignment and structure
>1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} Back     alignment and structure
>1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* Back     alignment and structure
>1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} Back     alignment and structure
>4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} Back     alignment and structure
>2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A Back     alignment and structure
>2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} Back     alignment and structure
>1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* Back     alignment and structure
>1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} Back     alignment and structure
>2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* Back     alignment and structure
>3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* Back     alignment and structure
>3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} Back     alignment and structure
>1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* Back     alignment and structure
>1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} Back     alignment and structure
>3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} Back     alignment and structure
>3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* Back     alignment and structure
>1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* Back     alignment and structure
>2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} Back     alignment and structure
>2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* Back     alignment and structure
>2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... Back     alignment and structure
>1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} Back     alignment and structure
>2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* Back     alignment and structure
>1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* Back     alignment and structure
>2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* Back     alignment and structure
>2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... Back     alignment and structure
>3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} Back     alignment and structure
>1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* Back     alignment and structure
>3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50} Back     alignment and structure
>3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} Back     alignment and structure
>1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Back     alignment and structure
>4f03_A Glutathione transferase; GST fold; 1.80A {Phanerochaete chrysosporium} PDB: 4g19_A* Back     alignment and structure
>1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A Back     alignment and structure
>3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* Back     alignment and structure
>1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A Back     alignment and structure
>1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A Back     alignment and structure
>3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A Back     alignment and structure
>3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Back     alignment and structure
>2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* Back     alignment and structure
>2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* Back     alignment and structure
>2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Back     alignment and structure
>1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2fno_A AGR_PAT_752P; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics, JCSG; 2.00A {Agrobacterium tumefaciens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* Back     alignment and structure
>1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* Back     alignment and structure
>2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} Back     alignment and structure
>3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>3m1g_A Putative glutathione S-transferase; ECM4-like subfamily, GST_C family, structural genomics, PSI- protein structure initiative; 2.10A {Corynebacterium glutamicum} Back     alignment and structure
>2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3ppu_A Glutathione-S-transferase; GST fold; HET: GSH; 2.30A {Phanerochaete chrysosporium} Back     alignment and structure
>2hsn_A Methionyl-tRNA synthetase, cytoplasmic; protein complex protein interaction GST-fold, ligase/RNA binding protein complex; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens} Back     alignment and structure
>2hra_A Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, ligase; 1.90A {Saccharomyces cerevisiae} PDB: 2hrk_A 2hsm_A Back     alignment and structure
>3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* Back     alignment and structure
>4fqu_A Putative glutathione transferase; glutathionyl-hydroquinone reductases, oxidoredu; 3.00A {Sphingobium chlorophenolicum} Back     alignment and structure
>4g0i_A Protein YQJG; glutathionyl-hydroquinone reductase, oxidoreductase; HET: MES; 2.05A {Escherichia coli} PDB: 3r3e_A* 4g0k_A* 4g0l_A* Back     alignment and structure
>1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* Back     alignment and structure
>2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} Back     alignment and structure
>2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} Back     alignment and structure
>3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 Back     alignment and structure
>1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 Back     alignment and structure
>3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 Back     alignment and structure
>1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A Back     alignment and structure
>1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A Back     alignment and structure
>1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A Back     alignment and structure
>3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} Back     alignment and structure
>3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* Back     alignment and structure
>2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0 Back     alignment and structure
>1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* Back     alignment and structure
>3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} Back     alignment and structure
>1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* Back     alignment and structure
>3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* Back     alignment and structure
>3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A Back     alignment and structure
>2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} Back     alignment and structure
>2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A Back     alignment and structure
>3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* Back     alignment and structure
>2kok_A Arsenate reductase; brucellosis, zoonotic, oxidoreductase, S genomics, seattle structural genomics center for infectious ssgcid; NMR {Brucella abortus} Back     alignment and structure
>3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B Back     alignment and structure
>3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae} Back     alignment and structure
>1u6t_A SH3 domain-binding glutamic acid-rich-like protein; SH3-binding, glutaredoxin, thioredoxin fold, crystallography, protein binding; HET: CIT; 1.90A {Homo sapiens} PDB: 1wry_A Back     alignment and structure
>1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A Back     alignment and structure
>3gkx_A Putative ARSC family related protein; ARSC family protein, structural genomi 2, protein structure initiative; 2.20A {Bacteroides fragilis} SCOP: c.47.1.0 Back     alignment and structure
>1z3e_A Regulatory protein SPX; bacterial transcription regulation, disulfide stress; 1.50A {Bacillus subtilis} SCOP: c.47.1.12 PDB: 3gfk_A 3ihq_A Back     alignment and structure
>3fz4_A Putative arsenate reductase; APC61768, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.38A {Streptococcus mutans UA159} SCOP: c.47.1.0 Back     alignment and structure
>3f0i_A Arsenate reductase; structural genomics, IDP01300, vibrio CH center for structural genomics of infectious diseases, CSGI oxidoreductase; HET: MSE; 1.88A {Vibrio cholerae} Back     alignment and structure
>1rw1_A Conserved hypothetical protein YFFB; thioredoxin fold, structure 2 function project, S2F, structu genomics, unknown function; HET: MSE IPA; 1.02A {Pseudomonas aeruginosa} SCOP: c.47.1.12 Back     alignment and structure
>3rdw_A Putative arsenate reductase; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; 2.20A {Yersinia pestis} Back     alignment and structure
>1s3c_A Arsenate reductase; ARSC, arsenite, oxidoreductase; 1.25A {Escherichia coli} PDB: 1sd9_A 1i9d_A 1j9b_A 1sd8_A 1jzw_A* 1sk1_A* 1sjz_A* 1sk0_A* 1sk2_A 1s3d_A Back     alignment and structure
>2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} Back     alignment and structure
>3l78_A Regulatory protein SPX; transcription, transcriptional factor, disulfide bond, redox-active center, transcription regulati; 1.90A {Streptococcus mutans} SCOP: c.47.1.12 Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>2jad_A Yellow fluorescent protein glutaredoxin fusion protein; electron transport, redox- active center, yeast, GRX1P, transport; HET: PIA; 2.7A {Aequorea victoria} Back     alignment and structure
>2wul_A Glutaredoxin related protein 5; chromosome 14 open reading frame 87, oxidoreductase, thiored family, GLRX5, FLB4739; HET: GSH; 2.40A {Homo sapiens} Back     alignment and structure
>2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea} Back     alignment and structure
>2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A Back     alignment and structure
>1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>2axo_A Hypothetical protein ATU2684; alpha beta protein., structural genomics, PSI, protein struc initiative; 1.80A {Agrobacterium tumefaciens str} SCOP: c.47.1.19 Back     alignment and structure
>1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 Back     alignment and structure
>3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP} Back     alignment and structure
>1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 Back     alignment and structure
>1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1 Back     alignment and structure
>2hqt_A GU4 nucleic-binding protein 1; GST-fold, biosynthetic protein, RNA binding; 1.90A {Saccharomyces cerevisiae} SCOP: a.45.1.2 PDB: 2hrk_B 2hsm_B 2hsn_B Back     alignment and structure
>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 126
d1jlva284 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anoph 5e-24
d1r5aa285 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anoph 1e-23
d1v2aa283 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anoph 4e-19
d1ljra279 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sap 4e-16
d1aw9a281 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), 3e-14
d1k0da292 c.47.1.5 (A:109-200) Yeast prion protein ure2p, ni 7e-14
d1axda280 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), 4e-13
d1gnwa284 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress ( 2e-12
d1n2aa280 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli 4e-12
d1pmta280 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabili 1e-11
d2fnoa287 c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752 3e-11
d1f2ea280 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas pau 8e-11
d1fw1a283 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapi 8e-10
d1e6ba280 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress 9e-10
d1okta285 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasm 3e-09
d1v2aa1125 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Ano 4e-09
d1g7oa275 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli 4e-09
d1tu7a277 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulu 5e-09
d1gula277 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sap 7e-09
d1r5aa1129 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Ano 8e-09
d2a2ra277 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapien 9e-09
d2c4ja284 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapien 2e-08
d1b48a278 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musc 5e-08
d1jlva1123 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Ano 7e-08
d1jlwa1127 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Ano 1e-07
d1ljra1 165 a.45.1.1 (A:80-244) Class theta GST {Human (Homo s 2e-07
d1fhea280 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepati 2e-07
d1nhya275 c.47.1.5 (A:1-75) GST-like domain of elongation fa 3e-07
d1eema298 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sa 3e-07
d1m0ua276 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Dr 5e-07
d2gsqa275 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastre 7e-07
d2cvda274 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sap 3e-06
d1z9ha2113 c.47.1.5 (A:100-212) Microsomal prostaglandin E sy 6e-06
d1k3ya279 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sap 8e-06
d1duga280 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma jap 1e-05
d1axda1129 a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays 3e-05
d1k0ma286 c.47.1.5 (A:6-91) Chloride intracellular channel 1 4e-05
d1oe8a281 c.47.1.5 (A:4-84) Class alpha GST {Blood fluke (Sc 5e-05
d1k0da1 151 a.45.1.1 (A:201-351) Yeast prion protein ure2p, ni 5e-05
d1oyja284 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativ 6e-05
d1tw9a277 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides 2e-04
d1gwca283 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii 3e-04
>d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Length = 84 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: Glutathione S-transferase (GST), N-terminal domain
domain: Class delta GST
species: Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]
 Score = 85.8 bits (212), Expect = 5e-24
 Identities = 55/87 (63%), Positives = 65/87 (74%), Gaps = 3/87 (3%)

Query: 3  IDFYYVPGSAPCRAVQLAAAQIGVPLNLKHTDLMKGEHLTPEFLKLNPQHTVPYSQQTNS 62
          +DFYY+PGSAPCRAVQ+ AA +GV LNLK T+LM GEH+ PEFLK+NPQH +P       
Sbjct: 1  MDFYYLPGSAPCRAVQMTAAAVGVELNLKLTNLMAGEHMKPEFLKINPQHCIPTLVDNGF 60

Query: 63 QEYRREESRAIIAYLAEQYGKDDSLYP 89
            +   ESRAI  YLAE+YGKDD LYP
Sbjct: 61 ALW---ESRAICTYLAEKYGKDDKLYP 84


>d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Length = 85 Back     information, alignment and structure
>d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Length = 83 Back     information, alignment and structure
>d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Length = 81 Back     information, alignment and structure
>d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 92 Back     information, alignment and structure
>d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Length = 80 Back     information, alignment and structure
>d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 84 Back     information, alignment and structure
>d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]} Length = 80 Back     information, alignment and structure
>d1pmta2 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabilis [TaxId: 584]} Length = 80 Back     information, alignment and structure
>d2fnoa2 c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} Length = 87 Back     information, alignment and structure
>d1f2ea2 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Length = 80 Back     information, alignment and structure
>d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1okta2 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 85 Back     information, alignment and structure
>d1v2aa1 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Length = 125 Back     information, alignment and structure
>d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure
>d1tu7a2 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Length = 77 Back     information, alignment and structure
>d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1r5aa1 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Length = 129 Back     information, alignment and structure
>d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d2c4ja2 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1b48a2 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1jlva1 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Length = 123 Back     information, alignment and structure
>d1jlwa1 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId: 123217]} Length = 127 Back     information, alignment and structure
>d1ljra1 a.45.1.1 (A:80-244) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure
>d1fhea2 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Length = 80 Back     information, alignment and structure
>d1nhya2 c.47.1.5 (A:1-75) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 Back     information, alignment and structure
>d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1m0ua2 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 76 Back     information, alignment and structure
>d2gsqa2 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Length = 75 Back     information, alignment and structure
>d2cvda2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Length = 113 Back     information, alignment and structure
>d1k3ya2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1duga2 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Length = 80 Back     information, alignment and structure
>d1axda1 a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Length = 129 Back     information, alignment and structure
>d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d1oe8a2 c.47.1.5 (A:4-84) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Length = 81 Back     information, alignment and structure
>d1k0da1 a.45.1.1 (A:201-351) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 151 Back     information, alignment and structure
>d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Length = 84 Back     information, alignment and structure
>d1tw9a2 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Length = 77 Back     information, alignment and structure
>d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Length = 83 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query126
d1jlva284 Class delta GST {Mosquito (Anopheles dirus b), iso 99.96
d1r5aa285 Class delta GST {Mosquito (Anopheles dirus b), iso 99.96
d1ljra279 Class theta GST {Human (Homo sapiens) [TaxId: 9606 99.95
d1aw9a281 Class phi GST {Maize (Zea mays), type III [TaxId: 99.95
d1axda280 Class phi GST {Maize (Zea mays), type I [TaxId: 45 99.95
d1v2aa283 Class delta GST {Mosquito (Anopheles dirus b), iso 99.95
d1gnwa284 Class phi GST {Mouse-ear cress (Arabidopsis thalia 99.94
d1k0da292 Yeast prion protein ure2p, nitrogen regulation fra 99.94
d1e6ba280 Class zeta GST {Mouse-ear cress (Arabidopsis thali 99.94
d1fw1a283 Class zeta GST {Human (Homo sapiens) [TaxId: 9606] 99.93
d1eema298 Class omega GST {Human (Homo sapiens) [TaxId: 9606 99.92
d1oyja284 Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} 99.91
d1n2aa280 Class beta GST {Escherichia coli [TaxId: 562]} 99.91
d1f2ea280 Class beta GST {Sphingomonas paucimobilis [TaxId: 99.91
d1pmta280 Class beta GST {Proteus mirabilis [TaxId: 584]} 99.91
d1g7oa275 Glutaredoxin 2 {Escherichia coli [TaxId: 562]} 99.9
d1tu7a277 Class pi GST {Onchocerca volvulus [TaxId: 6282]} 99.89
d1k0ma286 Chloride intracellular channel 1 (clic1) {Human (H 99.88
d1gwca283 Class tau GST {Aegilops tauschii, also known as Tr 99.87
d1m0ua276 Class sigma GST {Fruit fly (Drosophila melanogaste 99.86
d2gsqa275 Class sigma GST {Squid (Ommastrephes sloani pacifi 99.86
d2a2ra277 Class pi GST {Human (Homo sapiens) [TaxId: 9606]} 99.86
d2c4ja284 Class mu GST {Human (Homo sapiens) [TaxId: 9606]} 99.85
d2cvda274 Class sigma GST {Human (Homo sapiens) [TaxId: 9606 99.85
d2fnoa287 Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac 99.85
d1tw9a277 Class sigma GST {Heligmosomoides polygyrus [TaxId: 99.85
d1gula277 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 99.84
d1z9ha2113 Microsomal prostaglandin E synthase-2 {Crab-eating 99.84
d1okta285 Pf GST {Malarial parasite (Plasmodium falciparum) 99.83
d1b48a278 Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax 99.83
d1nhya275 GST-like domain of elongation factor 1-gamma {Bake 99.82
d1k3ya279 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 99.82
d1fhea280 Class alpha GST {Fasciola hepatica [TaxId: 6192]} 99.8
d1duga280 Class alpha GST {Schistosoma japonicum [TaxId: 618 99.8
d1oe8a281 Class alpha GST {Blood fluke (Schistosoma haematob 99.71
d1nm3a174 C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus 98.98
d1r7ha_74 Glutaredoxin-like NRDH-redoxin {Corynebacterium am 98.91
d1h75a_76 Glutaredoxin-like NRDH-redoxin {Escherichia coli [ 98.82
d1fova_82 Glutaredoxin (Grx, thioltransferase) {Escherichia 98.69
d1egoa_85 Glutaredoxin (Grx, thioltransferase) {Escherichia 98.33
d1abaa_87 Glutaredoxin (Grx, thioltransferase) {Bacteriophag 98.29
d1t1va_93 SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} 98.03
d1wika_109 Thioredoxin-like protein 2 {Mouse (Mus musculus) [ 97.86
d1ktea_105 Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr 97.85
d1wjka_100 Thioredoxin-like structure containing protein C330 97.81
d1ttza_75 Hypothetical protein XCC2852 {Xanthomonas campestr 97.43
d1axda1129 Class phi GST {Maize (Zea mays), type I [TaxId: 45 97.15
d1ljra1 165 Class theta GST {Human (Homo sapiens) [TaxId: 9606 97.15
d1aw9a1135 Class phi GST {Maize (Zea mays), type III [TaxId: 97.14
d1z3ea1114 Regulatory protein Spx {Bacillus subtilis [TaxId: 97.05
d1n2aa1121 Class beta GST {Escherichia coli [TaxId: 562]} 96.73
d1rw1a_114 Hypothetical protein PA3664 (YffB) {Pseudomonas ae 96.7
d1nhya1144 GST-like domain of elongation factor 1-gamma {Bake 96.31
d1f2ea1121 Class beta GST {Sphingomonas paucimobilis [TaxId: 96.27
d1pmta1121 Class beta GST {Proteus mirabilis [TaxId: 584]} 96.24
d1j9ba_138 Arsenate reductase ArsC {Escherichia coli [TaxId: 95.87
d1gnwa1126 Class phi GST {Mouse-ear cress (Arabidopsis thalia 94.94
d1iloa_77 MTH985, a thioredoxin {Archaeon Methanobacterium t 94.33
d1oyja1145 Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} 93.97
d1hyua496 Alkyl hydroperoxide reductase subunit F (AhpF), N- 92.93
d1nhoa_85 MTH807, thioredoxin/glutaredoxin-like protein {Arc 87.72
>d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: Glutathione S-transferase (GST), N-terminal domain
domain: Class delta GST
species: Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]
Probab=99.96  E-value=2e-29  Score=149.79  Aligned_cols=84  Identities=65%  Similarity=1.114  Sum_probs=79.4

Q ss_pred             eEEecCCCCchHHHHHHHHHHhCCCceEEEccCCCCCCCChhHhhhCCCCccceeeeecCCCeeeechHHHHHHHHHHhC
Q psy2059           3 IDFYYVPGSAPCRAVQLAAAQIGVPLNLKHTDLMKGEHLTPEFLKLNPQHTVPYSQQTNSQEYRREESRAIIAYLAEQYG   82 (126)
Q Consensus         3 ~~Ly~~~~s~~~~~v~~~l~~~gi~~~~~~v~~~~~~~~~~~~~~~~p~~~vP~L~~~~~~~~~l~eS~aI~~yL~~~~~   82 (126)
                      |+||+++.|++|++||++|+++|++|+.+.+++..++++.++|+++||.|+||+|   ++||.+|+||.||++||+++|+
T Consensus         1 mkLY~~~~S~~~~~v~~~l~e~gi~~e~~~v~~~~~~~~~~~~~~~nP~g~vP~L---~d~~~~l~ES~aI~~yL~~~~~   77 (84)
T d1jlva2           1 MDFYYLPGSAPCRAVQMTAAAVGVELNLKLTNLMAGEHMKPEFLKINPQHCIPTL---VDNGFALWESRAICTYLAEKYG   77 (84)
T ss_dssp             CEEEECTTCHHHHHHHHHHHHTTCCCEEEECCGGGTGGGSHHHHHHCTTCCSCEE---EETTEEEESHHHHHHHHHHHHC
T ss_pred             CEEEcCCCCHHHHHHHHHHHHcCCCCEEEEecCCCCccCCHHHHHHhccccCCEE---EECCEEEEcHHHHHHHHHHHcC
Confidence            6899999999999999999999999999999999888899999999999999999   8999999999999999999998


Q ss_pred             CCCCCCC
Q psy2059          83 KDDSLYP   89 (126)
Q Consensus        83 ~~~~l~p   89 (126)
                      .+..|+|
T Consensus        78 ~~~~L~P   84 (84)
T d1jlva2          78 KDDKLYP   84 (84)
T ss_dssp             CCGGGSC
T ss_pred             CCCCCCC
Confidence            7655776



>d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Back     information, alignment and structure
>d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Back     information, alignment and structure
>d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Back     information, alignment and structure
>d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Back     information, alignment and structure
>d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f2ea2 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Back     information, alignment and structure
>d1pmta2 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabilis [TaxId: 584]} Back     information, alignment and structure
>d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tu7a2 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Back     information, alignment and structure
>d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Back     information, alignment and structure
>d1m0ua2 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2gsqa2 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Back     information, alignment and structure
>d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4ja2 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cvda2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnoa2 c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1tw9a2 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Back     information, alignment and structure
>d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Back     information, alignment and structure
>d1okta2 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1b48a2 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Back     information, alignment and structure
>d1nhya2 c.47.1.5 (A:1-75) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k3ya2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d1fhea2 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Back     information, alignment and structure
>d1duga2 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Back     information, alignment and structure
>d1oe8a2 c.47.1.5 (A:4-84) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Back     information, alignment and structure
>d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} Back     information, alignment and structure
>d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} Back     information, alignment and structure
>d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1abaa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1t1va_ c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ttza_ c.47.1.1 (A:) Hypothetical protein XCC2852 {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1axda1 a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Back     information, alignment and structure
>d1ljra1 a.45.1.1 (A:80-244) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aw9a1 a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Back     information, alignment and structure
>d1z3ea1 c.47.1.12 (A:1-114) Regulatory protein Spx {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1n2aa1 a.45.1.1 (A:81-201) Class beta GST {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rw1a_ c.47.1.12 (A:) Hypothetical protein PA3664 (YffB) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1nhya1 a.45.1.1 (A:76-219) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f2ea1 a.45.1.1 (A:81-201) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Back     information, alignment and structure
>d1pmta1 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabilis [TaxId: 584]} Back     information, alignment and structure
>d1j9ba_ c.47.1.12 (A:) Arsenate reductase ArsC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gnwa1 a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1iloa_ c.47.1.1 (A:) MTH985, a thioredoxin {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1oyja1 a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure