Diaphorina citri psyllid: psy205


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MNRFFSSSGVPRGGSLRERTYSGDKQERAHHRRFSAHIVARRESTFTSIDAAIRRPSLAAVAERGSWGSRWEFLLSCVGLSVGIGNVWRFPYLAYQNGGGFLMRKQQQ
ccccccccccccccccccccccccccHHcccccccccEEEccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccCEEEEECcccEEEEEccc
****************************************************************GSWGSRWEFLLSCVGLSVGIGNVWRFPYLAYQNGGGFLMRKQ**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNRFFSSSGVPRGGSLRERTYSGDKQERAHHRRFSAHIVARRESTFTSIDAAIRRPSLAAVAERGSWGSRWEFLLSCVGLSVGIGNVWRFPYLAYQNGGGFLMRKQQQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Sodium- and chloride-dependent creatine transporter 1 Required for the uptake of creatine. Plays an important role in supplying creatine to the brain via the blood-brain barrier.confidentO18875

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005308 [MF]creatine transmembrane transporter activityprobableGO:0022891, GO:0051184, GO:0022892, GO:0005342, GO:0008514, GO:0005215, GO:0008509, GO:0072349, GO:0015075, GO:0022857, GO:0003674, GO:0015171, GO:0046943
GO:0001505 [BP]regulation of neurotransmitter levelsprobableGO:0044700, GO:0019226, GO:0032501, GO:0044707, GO:0035637, GO:0050877, GO:0009987, GO:0044763, GO:0008150, GO:0065007, GO:0023052, GO:0007268, GO:0007267, GO:0007154, GO:0065008, GO:0044699, GO:0003008
GO:0015844 [BP]monoamine transportprobableGO:0006810, GO:0071705, GO:0044765, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699
GO:0005332 [MF]gamma-aminobutyric acid:sodium symporter activityprobableGO:0005342, GO:0005343, GO:0008028, GO:0003674, GO:0015185, GO:0005416, GO:0015081, GO:0008509, GO:0022857, GO:0015370, GO:0046873, GO:0022804, GO:0015294, GO:0015291, GO:0015293, GO:0005215, GO:0008324, GO:0046943, GO:0022891, GO:0022890, GO:0022892, GO:0005283, GO:0015075, GO:0008514, GO:0015077, GO:0015171
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0015812 [BP]gamma-aminobutyric acid transportprobableGO:0006810, GO:0015718, GO:0044765, GO:0015849, GO:0006811, GO:0006865, GO:0015711, GO:0071705, GO:0006820, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699, GO:0046942
GO:0006836 [BP]neurotransmitter transportprobableGO:0006810, GO:0044765, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0042165 [MF]neurotransmitter bindingprobableGO:0003674, GO:0005488
GO:0008504 [MF]monoamine transmembrane transporter activityprobableGO:0022891, GO:0022892, GO:0005215, GO:0022857, GO:0003674, GO:0022804
GO:0030424 [CC]axonprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0015881 [BP]creatine transportprobableGO:0006810, GO:0044765, GO:0015849, GO:0006811, GO:0006865, GO:0015711, GO:0071705, GO:0006820, GO:0008150, GO:0071702, GO:0072337, GO:0051234, GO:0051179, GO:0044699, GO:0046942
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0055085 [BP]transmembrane transportprobableGO:0006810, GO:0009987, GO:0044765, GO:0008150, GO:0044763, GO:0051234, GO:0051179, GO:0044699
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2A65, chain A
Confidence level:very confident
Coverage over the Query: 64-107
View the alignment between query and template
View the model in PyMOL