Diaphorina citri psyllid: psy2060


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190---
LKQRNRLHIKLQYQVDLTNGPFQPYLSGLPDNEGLEKRVQTFVDGGHRTLDLLHDMGARYHWGDTCETDITKSDCKGVCSPGATCSLNPSGGYICDDCSLAGSYEHYDRLCRLRARSFPKNSFLTFPALKQRNRLHIKLQFSTLHDSGLLLYNGRYNERHDFIALELTDSGRSVQFSWSLGSEVARLNRADSI
cccccccEEEEEEEEcccccccccccccccccccccccEEEEEcccccccccEEEccccccccccccccccccccccccccccCEECcccccEEEcccccccccccccccccccccccccccEEEcccccccEEEEEEEEEEEccccEEEEECccccccccEEEEEEEccccEEEEEEEccccEEEEEEcccc
******LHIKLQYQVDLTNGPFQPYLSGLPDNEGLEKRVQTFVDGGHRTLDLLHDMGARYHWGDTCETDITKSDCKGVCSPGATCSLNPSGGYICDDCSLAGSYEHYDRLCRLRARSFPKNSFLTFPALKQRNRLHIKLQFSTLHDSGLLLYNGRYNERHDFIALELTDSGRSVQFSWSLGSEVARLN*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LKQRNRLHIKLQYQVDLTNGPFQPYLSGLPDNEGLEKRVQTFVDGGHRTLDLLHDMGARYHWGDTCETDITKSDCKGVCSPGATCSLNPSGGYICDDCSLAGSYEHYDRLCRLRARSFPKNSFLTFPALKQRNRLHIKLQFSTLHDSGLLLYNGRYNERHDFIALELTDSGRSVQFSWSLGSEVARLNRADSI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044464 [CC]cell partprobableGO:0005575, GO:0005623
GO:0019219 [BP]regulation of nucleobase-containing compound metabolic processprobableGO:0080090, GO:0019222, GO:0031323, GO:0050794, GO:0065007, GO:0051171, GO:0008150, GO:0050789
GO:0044700 [BP]single organism signalingprobableGO:0008150, GO:0023052, GO:0044699
GO:0044707 [BP]single-multicellular organism processprobableGO:0032501, GO:0008150, GO:0044699
GO:0032502 [BP]developmental processprobableGO:0008150
GO:0060255 [BP]regulation of macromolecule metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0007154 [BP]cell communicationprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3QCW, chain A
Confidence level:very confident
Coverage over the Query: 65-189
View the alignment between query and template
View the model in PyMOL
Template: 2GY5, chain A
Confidence level:confident
Coverage over the Query: 24-190
View the alignment between query and template
View the model in PyMOL