Psyllid ID: psy2060
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 193 | ||||||
| 328710949 | 3166 | PREDICTED: protocadherin-like wing polar | 0.637 | 0.038 | 0.685 | 1e-44 | |
| 328710951 | 3165 | PREDICTED: protocadherin-like wing polar | 0.647 | 0.039 | 0.674 | 1e-44 | |
| 91090474 | 3246 | PREDICTED: similar to cadherin [Triboliu | 0.658 | 0.039 | 0.515 | 2e-30 | |
| 270014310 | 3257 | starry night [Tribolium castaneum] | 0.658 | 0.038 | 0.515 | 3e-30 | |
| 307210796 | 3166 | Protocadherin-like wing polarity protein | 0.626 | 0.038 | 0.552 | 2e-29 | |
| 340723065 | 3163 | PREDICTED: protocadherin-like wing polar | 0.626 | 0.038 | 0.52 | 3e-29 | |
| 383849585 | 3164 | PREDICTED: protocadherin-like wing polar | 0.626 | 0.038 | 0.52 | 3e-29 | |
| 350414007 | 3163 | PREDICTED: protocadherin-like wing polar | 0.626 | 0.038 | 0.52 | 3e-29 | |
| 380014510 | 3167 | PREDICTED: LOW QUALITY PROTEIN: protocad | 0.626 | 0.038 | 0.488 | 9e-29 | |
| 328778418 | 3163 | PREDICTED: protocadherin-like wing polar | 0.626 | 0.038 | 0.512 | 1e-28 |
| >gi|328710949|ref|XP_001947627.2| PREDICTED: protocadherin-like wing polarity protein stan-like isoform 3 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 184 bits (468), Expect = 1e-44, Method: Compositional matrix adjust.
Identities = 85/124 (68%), Positives = 104/124 (83%), Gaps = 1/124 (0%)
Query: 63 GDTCETDITKSDCK-GVCSPGATCSLNPSGGYICDDCSLAGSYEHYDRLCRLRARSFPKN 121
GD CE ++ +CK G+C GATC+ SGG++CDDCS AG++EHYD +CRLR+RSFPK+
Sbjct: 1433 GDNCEINLKHDECKPGICHSGATCTPLKSGGFLCDDCSPAGTFEHYDEVCRLRSRSFPKS 1492
Query: 122 SFLTFPALKQRNRLHIKLQFSTLHDSGLLLYNGRYNERHDFIALELTDSGRSVQFSWSLG 181
SFLTFP+L+QR RLHI L+FSTL +SGLLLYNGRYNERHDFIALEL + GR +QFS+SLG
Sbjct: 1493 SFLTFPSLRQRYRLHISLKFSTLEESGLLLYNGRYNERHDFIALELVEGGRGMQFSFSLG 1552
Query: 182 SEVA 185
SEV
Sbjct: 1553 SEVT 1556
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|328710951|ref|XP_003244410.1| PREDICTED: protocadherin-like wing polarity protein stan-like isoform 2 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|91090474|ref|XP_968232.1| PREDICTED: similar to cadherin [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|270014310|gb|EFA10758.1| starry night [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|307210796|gb|EFN87178.1| Protocadherin-like wing polarity protein stan [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|340723065|ref|XP_003399918.1| PREDICTED: protocadherin-like wing polarity protein stan-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|383849585|ref|XP_003700425.1| PREDICTED: protocadherin-like wing polarity protein stan-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|350414007|ref|XP_003490178.1| PREDICTED: protocadherin-like wing polarity protein stan-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|380014510|ref|XP_003691272.1| PREDICTED: LOW QUALITY PROTEIN: protocadherin-like wing polarity protein stan-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|328778418|ref|XP_624236.3| PREDICTED: protocadherin-like wing polarity protein stan-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 193 | ||||||
| UNIPROTKB|F1MHH5 | 3300 | CELSR3 "Uncharacterized protei | 0.590 | 0.034 | 0.466 | 1.4e-20 | |
| UNIPROTKB|D4AC66 | 3303 | Celsr3 "Cadherin EGF LAG seven | 0.590 | 0.034 | 0.466 | 1.8e-20 | |
| UNIPROTKB|F1SKK7 | 3307 | CELSR3 "Uncharacterized protei | 0.590 | 0.034 | 0.466 | 1.8e-20 | |
| UNIPROTKB|Q9NYQ7 | 3312 | CELSR3 "Cadherin EGF LAG seven | 0.590 | 0.034 | 0.466 | 1.8e-20 | |
| RGD|621787 | 3313 | Celsr3 "cadherin, EGF LAG seve | 0.590 | 0.034 | 0.466 | 1.8e-20 | |
| UNIPROTKB|O88278 | 3313 | Celsr3 "Cadherin EGF LAG seven | 0.590 | 0.034 | 0.466 | 1.8e-20 | |
| UNIPROTKB|J9NZ15 | 3323 | CELSR3 "Uncharacterized protei | 0.590 | 0.034 | 0.458 | 2.4e-20 | |
| FB|FBgn0024836 | 3579 | stan "starry night" [Drosophil | 0.611 | 0.032 | 0.460 | 2.6e-20 | |
| UNIPROTKB|F1N812 | 3737 | SLC26A6 "Uncharacterized prote | 0.606 | 0.031 | 0.456 | 3.4e-20 | |
| MGI|MGI:1858236 | 3301 | Celsr3 "cadherin, EGF LAG seve | 0.575 | 0.033 | 0.470 | 1e-19 |
| UNIPROTKB|F1MHH5 CELSR3 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Score = 261 (96.9 bits), Expect = 1.4e-20, P = 1.4e-20
Identities = 56/120 (46%), Positives = 75/120 (62%)
Query: 63 GDTCETDITKSDC-KGVCSPGATCSLNPSGGYICDDCSLAGSYEHYDRLCRLRARSFPKN 121
G+ CE D C GVC G TC+ P GG+ C C G++E R C + ARSFP +
Sbjct: 1449 GEDCELDTEAGRCVPGVCRNGGTCANGPDGGFRCQ-CPAGGAFEG-PR-CEVAARSFPPS 1505
Query: 122 SFLTFPALKQRNRLHIKLQFSTLHDSGLLLYNGRYNERHDFIALELTDSGRSVQFSWSLG 181
SF+ F L+QR L + L F+T+ SGLL YNGR NE+HDF+ALEL +G+ V+ ++S G
Sbjct: 1506 SFVMFRGLRQRFHLTLSLSFATVQPSGLLFYNGRLNEKHDFLALELV-AGQ-VRLTYSTG 1563
|
|
| UNIPROTKB|D4AC66 Celsr3 "Cadherin EGF LAG seven-pass G-type receptor 3" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SKK7 CELSR3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9NYQ7 CELSR3 "Cadherin EGF LAG seven-pass G-type receptor 3" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| RGD|621787 Celsr3 "cadherin, EGF LAG seven-pass G-type receptor 3" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O88278 Celsr3 "Cadherin EGF LAG seven-pass G-type receptor 3" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9NZ15 CELSR3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0024836 stan "starry night" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N812 SLC26A6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1858236 Celsr3 "cadherin, EGF LAG seven-pass G-type receptor 3 (flamingo homolog, Drosophila)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 193 | |||
| cd00110 | 151 | cd00110, LamG, Laminin G domain; Laminin G-like do | 1e-11 | |
| smart00282 | 132 | smart00282, LamG, Laminin G domain | 1e-07 | |
| pfam00054 | 131 | pfam00054, Laminin_G_1, Laminin G domain | 1e-05 | |
| pfam02210 | 124 | pfam02210, Laminin_G_2, Laminin G domain | 1e-04 |
| >gnl|CDD|238058 cd00110, LamG, Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans | Back alignment and domain information |
|---|
Score = 59.7 bits (145), Expect = 1e-11
Identities = 31/74 (41%), Positives = 38/74 (51%), Gaps = 4/74 (5%)
Query: 115 ARSFPKNSFLTFPALK-QRNRLHIKLQFSTLHDSGLLLYNGRYNERHDFIALELTDSGRS 173
SF +S++ P L R RL I F T +GLLLY G N DF+ALEL D GR
Sbjct: 1 GVSFSGSSYVRLPTLPAPRTRLSISFSFRTTSPNGLLLYAGSQN-GGDFLALELED-GR- 57
Query: 174 VQFSWSLGSEVARL 187
+ + LGS L
Sbjct: 58 LVLRYDLGSGSLVL 71
|
Proteins that contain LamG domains serve a variety of purposes including signal transduction via cell-surface steroid receptors, adhesion, migration and differentiation through mediation of cell adhesion molecules. Length = 151 |
| >gnl|CDD|214598 smart00282, LamG, Laminin G domain | Back alignment and domain information |
|---|
| >gnl|CDD|215681 pfam00054, Laminin_G_1, Laminin G domain | Back alignment and domain information |
|---|
| >gnl|CDD|216930 pfam02210, Laminin_G_2, Laminin G domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 193 | |||
| KOG4289|consensus | 2531 | 99.95 | ||
| KOG4289|consensus | 2531 | 99.46 | ||
| KOG1219|consensus | 4289 | 99.43 | ||
| KOG1219|consensus | 4289 | 99.16 | ||
| PF00054 | 131 | Laminin_G_1: Laminin G domain; InterPro: IPR012679 | 98.95 | |
| KOG3516|consensus | 1306 | 98.94 | ||
| KOG3514|consensus | 1591 | 98.87 | ||
| KOG3514|consensus | 1591 | 98.87 | ||
| cd00110 | 151 | LamG Laminin G domain; Laminin G-like domains are | 98.83 | |
| KOG3516|consensus | 1306 | 98.76 | ||
| smart00282 | 135 | LamG Laminin G domain. | 98.41 | |
| KOG1225|consensus | 525 | 98.21 | ||
| PF00008 | 32 | EGF: EGF-like domain This is a sub-family of the P | 98.06 | |
| PF02210 | 128 | Laminin_G_2: Laminin G domain; InterPro: IPR012680 | 98.03 | |
| PF07645 | 42 | EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 | 97.64 | |
| KOG1214|consensus | 1289 | 97.55 | ||
| PF12661 | 13 | hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E | 97.41 | |
| KOG1217|consensus | 487 | 97.36 | ||
| smart00179 | 39 | EGF_CA Calcium-binding EGF-like domain. | 97.29 | |
| KOG1225|consensus | 525 | 97.28 | ||
| KOG4260|consensus | 350 | 97.26 | ||
| cd00054 | 38 | EGF_CA Calcium-binding EGF-like domain, present in | 97.19 | |
| KOG1217|consensus | 487 | 97.13 | ||
| cd00053 | 36 | EGF Epidermal growth factor domain, found in epide | 96.96 | |
| smart00181 | 35 | EGF Epidermal growth factor-like domain. | 96.79 | |
| KOG1214|consensus | 1289 | 96.72 | ||
| PF12947 | 36 | EGF_3: EGF domain; InterPro: IPR024731 This entry | 96.28 | |
| PF00008 | 32 | EGF: EGF-like domain This is a sub-family of the P | 96.17 | |
| PF14670 | 36 | FXa_inhibition: Coagulation Factor Xa inhibitory s | 95.83 | |
| smart00179 | 39 | EGF_CA Calcium-binding EGF-like domain. | 95.77 | |
| KOG1836|consensus | 1705 | 95.71 | ||
| smart00051 | 63 | DSL delta serrate ligand. | 95.63 | |
| PF12662 | 24 | cEGF: Complement Clr-like EGF-like | 95.57 | |
| cd00054 | 38 | EGF_CA Calcium-binding EGF-like domain, present in | 95.13 | |
| PF12662 | 24 | cEGF: Complement Clr-like EGF-like | 95.11 | |
| smart00181 | 35 | EGF Epidermal growth factor-like domain. | 95.07 | |
| KOG1226|consensus | 783 | 94.98 | ||
| PF14670 | 36 | FXa_inhibition: Coagulation Factor Xa inhibitory s | 94.9 | |
| cd00053 | 36 | EGF Epidermal growth factor domain, found in epide | 94.14 | |
| KOG0994|consensus | 1758 | 94.1 | ||
| PHA03099 | 139 | epidermal growth factor-like protein (EGF-like pro | 94.03 | |
| PF07645 | 42 | EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 | 93.81 | |
| PHA02887 | 126 | EGF-like protein; Provisional | 93.52 | |
| PF07974 | 32 | EGF_2: EGF-like domain; InterPro: IPR013111 A sequ | 93.44 | |
| PHA03099 | 139 | epidermal growth factor-like protein (EGF-like pro | 92.94 | |
| smart00051 | 63 | DSL delta serrate ligand. | 92.9 | |
| PHA02887 | 126 | EGF-like protein; Provisional | 92.88 | |
| KOG1226|consensus | 783 | 92.69 | ||
| PF07974 | 32 | EGF_2: EGF-like domain; InterPro: IPR013111 A sequ | 91.56 | |
| KOG4260|consensus | 350 | 91.45 | ||
| KOG3509|consensus | 964 | 90.58 | ||
| PF01414 | 63 | DSL: Delta serrate ligand; InterPro: IPR001774 Lig | 88.65 | |
| KOG1836|consensus | 1705 | 87.18 | ||
| PF12946 | 37 | EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 | 86.96 | |
| PF06247 | 197 | Plasmod_Pvs28: Plasmodium ookinete surface protein | 83.98 | |
| cd01475 | 224 | vWA_Matrilin VWA_Matrilin: In cartilaginous plate, | 83.58 | |
| PF06247 | 197 | Plasmod_Pvs28: Plasmodium ookinete surface protein | 83.08 | |
| KOG0994|consensus | 1758 | 83.06 |
| >KOG4289|consensus | Back alignment and domain information |
|---|
Probab=99.95 E-value=5.9e-28 Score=218.31 Aligned_cols=160 Identities=36% Similarity=0.648 Sum_probs=142.7
Q ss_pred CCCCCcee-cCCCCccCCCCcceeec---------CC--ccCCCCceeeCCCCCCCCcccccCCCCCCC-CCCCCCcEEe
Q psy2060 20 GPFQPYLS-GLPDNEGLEKRVQTFVD---------GG--HRTLDLLHDMGARYHWGDTCETDITKSDCK-GVCSPGATCS 86 (193)
Q Consensus 20 ~~~~~~~c-C~~g~~g~~~~c~~~~~---------gg--~~~~~~~~C~C~~g~~G~~C~~~~~~~~C~-~pC~~gg~C~ 86 (193)
.|...+.| |||||+|.. ||+.+| +| ..-.++|.|.|.+||+|.+||.+.....|. ..|.|||+|+
T Consensus 1217 ~pvnglrCrCPpGFTgd~--CeTeiDlCYs~pC~nng~C~srEggYtCeCrpg~tGehCEvs~~agrCvpGvC~nggtC~ 1294 (2531)
T KOG4289|consen 1217 HPVNGLRCRCPPGFTGDY--CETEIDLCYSGPCGNNGRCRSREGGYTCECRPGFTGEHCEVSARAGRCVPGVCKNGGTCV 1294 (2531)
T ss_pred cccCceeEeCCCCCCccc--ccchhHhhhcCCCCCCCceEEecCceeEEecCCccccceeeecccCccccceecCCCEEe
Confidence 45667789 999999998 999888 33 455789999999999999999887557899 9999999999
Q ss_pred eCCCCceecccCCCCCCccccccccceecccCCCcceEEecCCCCCceeEEEEEEEeCCCCeEEEEeecCCCCCceEEEE
Q psy2060 87 LNPSGGYICDDCSLAGSYEHYDRLCRLRARSFPKNSFLTFPALKQRNRLHIKLQFSTLHDSGLLLYNGRYNERHDFIALE 166 (193)
Q Consensus 87 ~~~~~~~~C~~C~~g~~~~~~g~~C~~~~~sF~g~syl~~~~~~~~~~~~i~~~f~T~~~~glLl~~g~~~~~~dfi~l~ 166 (193)
+...++|.|+ ||.+ ..+ +++|+..+.+|.+.+|+.+.....+.++.++|.|.|...+|+|+|+| ++++||++|+
T Consensus 1295 ~~~nggf~c~-Cp~g-e~e--~prC~v~trSFp~~sfv~frglrqRfh~TlslsfaT~~~nGlL~ynG--nekhDFvale 1368 (2531)
T KOG4289|consen 1295 NLLNGGFCCH-CPYG-EFE--DPRCEVTTRSFPPESFVTFRGLRQRFHFTLSLSFATIERNGLLLYNG--NEKHDFVALE 1368 (2531)
T ss_pred ecCCCceecc-CCCc-ccC--CCceEEEeeccCchheEEEeccccceEEEEEEEEEEeeecceEEecC--CcccceEeee
Confidence 9887999999 9987 333 99999999999999999999999999999999999999999999999 7899999999
Q ss_pred ecCCeeEEEEEEeCCCceEEEEc
Q psy2060 167 LTDSGRSVQFSWSLGSEVARLNR 189 (193)
Q Consensus 167 l~~G~~~l~~~~~~g~g~~~l~s 189 (193)
++++. |+++|+.|...+++..
T Consensus 1369 vVd~q--vqltfS~Ges~t~v~p 1389 (2531)
T KOG4289|consen 1369 VVDEQ--VQLTFSAGESTTTVSP 1389 (2531)
T ss_pred eeeee--EEEEEecccccceecC
Confidence 99999 9999999966555543
|
|
| >KOG4289|consensus | Back alignment and domain information |
|---|
| >KOG1219|consensus | Back alignment and domain information |
|---|
| >KOG1219|consensus | Back alignment and domain information |
|---|
| >PF00054 Laminin_G_1: Laminin G domain; InterPro: IPR012679 Laminins are large heterotrimeric glycoproteins involved in basement membrane function [] | Back alignment and domain information |
|---|
| >KOG3516|consensus | Back alignment and domain information |
|---|
| >KOG3514|consensus | Back alignment and domain information |
|---|
| >KOG3514|consensus | Back alignment and domain information |
|---|
| >cd00110 LamG Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans | Back alignment and domain information |
|---|
| >KOG3516|consensus | Back alignment and domain information |
|---|
| >smart00282 LamG Laminin G domain | Back alignment and domain information |
|---|
| >KOG1225|consensus | Back alignment and domain information |
|---|
| >PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >PF02210 Laminin_G_2: Laminin G domain; InterPro: IPR012680 Laminins are large heterotrimeric glycoproteins involved in basement membrane function [] | Back alignment and domain information |
|---|
| >PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins | Back alignment and domain information |
|---|
| >KOG1214|consensus | Back alignment and domain information |
|---|
| >PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A | Back alignment and domain information |
|---|
| >KOG1217|consensus | Back alignment and domain information |
|---|
| >smart00179 EGF_CA Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >KOG1225|consensus | Back alignment and domain information |
|---|
| >KOG4260|consensus | Back alignment and domain information |
|---|
| >cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >KOG1217|consensus | Back alignment and domain information |
|---|
| >cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
| >smart00181 EGF Epidermal growth factor-like domain | Back alignment and domain information |
|---|
| >KOG1214|consensus | Back alignment and domain information |
|---|
| >PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins | Back alignment and domain information |
|---|
| >PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A | Back alignment and domain information |
|---|
| >smart00179 EGF_CA Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >KOG1836|consensus | Back alignment and domain information |
|---|
| >smart00051 DSL delta serrate ligand | Back alignment and domain information |
|---|
| >PF12662 cEGF: Complement Clr-like EGF-like | Back alignment and domain information |
|---|
| >cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >PF12662 cEGF: Complement Clr-like EGF-like | Back alignment and domain information |
|---|
| >smart00181 EGF Epidermal growth factor-like domain | Back alignment and domain information |
|---|
| >KOG1226|consensus | Back alignment and domain information |
|---|
| >PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A | Back alignment and domain information |
|---|
| >cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
| >KOG0994|consensus | Back alignment and domain information |
|---|
| >PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional | Back alignment and domain information |
|---|
| >PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins | Back alignment and domain information |
|---|
| >PHA02887 EGF-like protein; Provisional | Back alignment and domain information |
|---|
| >PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional | Back alignment and domain information |
|---|
| >smart00051 DSL delta serrate ligand | Back alignment and domain information |
|---|
| >PHA02887 EGF-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG1226|consensus | Back alignment and domain information |
|---|
| >PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >KOG4260|consensus | Back alignment and domain information |
|---|
| >KOG3509|consensus | Back alignment and domain information |
|---|
| >PF01414 DSL: Delta serrate ligand; InterPro: IPR001774 Ligands of the Delta/Serrate/lag-2 (DSL) family and their receptors, members of the lin-12/Notch family, mediate cell-cell interactions that specify cell fate in invertebrates and vertebrates | Back alignment and domain information |
|---|
| >KOG1836|consensus | Back alignment and domain information |
|---|
| >PF12946 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 This EGF-like domain is found at the C terminus of the malaria parasite MSP1 protein | Back alignment and domain information |
|---|
| >PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium | Back alignment and domain information |
|---|
| >cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity | Back alignment and domain information |
|---|
| >PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium | Back alignment and domain information |
|---|
| >KOG0994|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 193 | |||
| 1pz7_A | 204 | Agrin; structural protein; 1.42A {Gallus gallus} S | 1e-20 | |
| 3v64_A | 191 | Low-density lipoprotein receptor-related protein; | 1e-16 | |
| 3asi_A | 410 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sy | 4e-15 | |
| 3asi_A | 410 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sy | 1e-09 | |
| 2wjs_A | 608 | Laminin subunit alpha-2; integrin, secreted, coile | 1e-14 | |
| 2wjs_A | 608 | Laminin subunit alpha-2; integrin, secreted, coile | 1e-11 | |
| 2wjs_A | 608 | Laminin subunit alpha-2; integrin, secreted, coile | 3e-09 | |
| 3pve_A | 189 | Agrin, AGRN protein; mRNA splicing, structural gen | 1e-14 | |
| 3sh4_A | 195 | LG3 peptide; actin disassambly, integrin alpha12 B | 2e-14 | |
| 2h0b_A | 184 | Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A | 1e-13 | |
| 2jd4_A | 383 | Laminin subunit alpha-1; basement membrane protein | 1e-13 | |
| 2jd4_A | 383 | Laminin subunit alpha-1; basement membrane protein | 5e-06 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 4e-13 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 1e-12 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 1e-12 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 3e-10 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 4e-08 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 4e-07 | |
| 1dyk_A | 394 | Laminin alpha 2 chain; metal binding protein; 2.0A | 5e-12 | |
| 1dyk_A | 394 | Laminin alpha 2 chain; metal binding protein; 2.0A | 1e-05 | |
| 2r16_A | 182 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sp | 3e-11 | |
| 1f5f_A | 205 | SHBG, sex hormone-binding globulin; jellyroll, sig | 1e-10 | |
| 1h30_A | 422 | GAS6, growth-arrest-specific protein; laminin G-do | 2e-10 | |
| 3bod_A | 178 | Neurexin-1-alpha; neurexin1D, LNS6, alternative sp | 4e-10 | |
| 1d2s_A | 170 | SHBG, sex hormone-binding globulin; steroid transp | 7e-10 | |
| 2r1b_A | 220 | Neurexin-1-beta, neurexin I-beta; beta-sandwich, c | 2e-08 | |
| 2r1d_A | 226 | Neurexin-1-beta, neurexin I-beta; beta-sandwich, c | 3e-08 |
| >1pz7_A Agrin; structural protein; 1.42A {Gallus gallus} SCOP: b.29.1.4 PDB: 1pz8_A 1pz9_A 1q56_A Length = 204 | Back alignment and structure |
|---|
Score = 84.1 bits (208), Expect = 1e-20
Identities = 25/81 (30%), Positives = 37/81 (45%), Gaps = 2/81 (2%)
Query: 107 YDRLCRLRARSFPKNSFLTFPALKQRNRLHIKLQFSTLHDSGLLLYNGRYNERHDFIALE 166
Y +S + P+ K H +L T GL+L++G+ ER D+IAL
Sbjct: 22 YMEYHNAVTKSPDALDYPAEPSEKALQSNHFELSIKTEATQGLILWSGKGLERSDYIALA 81
Query: 167 LTDSGRSVQFSWSLGSEVARL 187
+ D G VQ + LGS+ L
Sbjct: 82 IVD-GF-VQMMYDLGSKPVVL 100
|
| >3v64_A Low-density lipoprotein receptor-related protein; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} PDB: 3v65_A Length = 191 | Back alignment and structure |
|---|
| >3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 | Back alignment and structure |
|---|
| >3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 | Back alignment and structure |
|---|
| >2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Length = 608 | Back alignment and structure |
|---|
| >2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Length = 608 | Back alignment and structure |
|---|
| >2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Length = 608 | Back alignment and structure |
|---|
| >3pve_A Agrin, AGRN protein; mRNA splicing, structural genomics, PSI-2, protein structure initiative; 1.40A {Mus musculus} Length = 189 | Back alignment and structure |
|---|
| >3sh4_A LG3 peptide; actin disassambly, integrin alpha12 BETA1, metal binding Pro; 1.50A {Homo sapiens} PDB: 3sh5_A Length = 195 | Back alignment and structure |
|---|
| >2h0b_A Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A {Bos taurus} Length = 184 | Back alignment and structure |
|---|
| >2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} Length = 383 | Back alignment and structure |
|---|
| >2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} Length = 383 | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 | Back alignment and structure |
|---|
| >1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A Length = 394 | Back alignment and structure |
|---|
| >1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A Length = 394 | Back alignment and structure |
|---|
| >2r16_A Neurexin-1-alpha; beta-sandwich, cell adhesion, splicing; 1.04A {Bos taurus} Length = 182 | Back alignment and structure |
|---|
| >1f5f_A SHBG, sex hormone-binding globulin; jellyroll, signaling protein; HET: DHT; 1.70A {Homo sapiens} SCOP: b.29.1.4 PDB: 1lhw_A* 1lho_A* 1lhn_A* 1lhv_A* 1lhu_A* Length = 205 | Back alignment and structure |
|---|
| >1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* Length = 422 | Back alignment and structure |
|---|
| >3bod_A Neurexin-1-alpha; neurexin1D, LNS6, alternative splicing, calcium, cell adhesion, EGF-like domain, glycoprotein, membrane, metal- binding; 1.70A {Mus musculus} PDB: 2vh8_C 2xb6_C* 2wqz_C* 1c4r_A 3bop_A 3mw4_A* Length = 178 | Back alignment and structure |
|---|
| >1d2s_A SHBG, sex hormone-binding globulin; steroid transport, laminin G-like domain, jellyroll, androgen binding protein (ABP); HET: DHT; 1.55A {Homo sapiens} SCOP: b.29.1.4 PDB: 1kdk_A* 1kdm_A* Length = 170 | Back alignment and structure |
|---|
| >2r1b_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 1.72A {Rattus norvegicus} PDB: 3mw2_A* 3b3q_E* 3mw3_A* Length = 220 | Back alignment and structure |
|---|
| >2r1d_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 2.60A {Rattus norvegicus} SCOP: b.29.1.4 PDB: 3biw_E* Length = 226 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 193 | |||
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 99.62 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 99.59 | |
| 3asi_A | 410 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sy | 99.57 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 99.52 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 99.52 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 99.51 | |
| 1pz7_A | 204 | Agrin; structural protein; 1.42A {Gallus gallus} S | 99.43 | |
| 1h30_A | 422 | GAS6, growth-arrest-specific protein; laminin G-do | 99.41 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 99.4 | |
| 3pve_A | 189 | Agrin, AGRN protein; mRNA splicing, structural gen | 99.3 | |
| 3v64_A | 191 | Low-density lipoprotein receptor-related protein; | 99.26 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 99.23 | |
| 2r16_A | 182 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sp | 99.23 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 99.23 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 99.19 | |
| 1d2s_A | 170 | SHBG, sex hormone-binding globulin; steroid transp | 99.17 | |
| 3sh4_A | 195 | LG3 peptide; actin disassambly, integrin alpha12 B | 99.16 | |
| 3asi_A | 410 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sy | 99.14 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 99.13 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 99.12 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 99.11 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 99.1 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 99.08 | |
| 3u7u_G | 55 | Neuregulin 1; signaling protein, transferase-trans | 99.06 | |
| 1f5f_A | 205 | SHBG, sex hormone-binding globulin; jellyroll, sig | 99.05 | |
| 2jd4_A | 383 | Laminin subunit alpha-1; basement membrane protein | 99.04 | |
| 2r1b_A | 220 | Neurexin-1-beta, neurexin I-beta; beta-sandwich, c | 99.02 | |
| 2h0b_A | 184 | Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A | 99.01 | |
| 3bod_A | 178 | Neurexin-1-alpha; neurexin1D, LNS6, alternative sp | 99.0 | |
| 2r1d_A | 226 | Neurexin-1-beta, neurexin I-beta; beta-sandwich, c | 98.99 | |
| 4fbr_A | 267 | Lectin, myxobacterial hemagglutinin; beta-barrel, | 98.97 | |
| 1dyk_A | 394 | Laminin alpha 2 chain; metal binding protein; 2.0A | 98.95 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 98.93 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 98.9 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 98.89 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 98.88 | |
| 2wjs_A | 608 | Laminin subunit alpha-2; integrin, secreted, coile | 98.87 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 98.86 | |
| 2wjs_A | 608 | Laminin subunit alpha-2; integrin, secreted, coile | 98.85 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 98.84 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 98.84 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 98.83 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 98.8 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 98.78 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 98.76 | |
| 4fbr_A | 267 | Lectin, myxobacterial hemagglutinin; beta-barrel, | 98.76 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 98.74 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 98.7 | |
| 2jd4_A | 383 | Laminin subunit alpha-1; basement membrane protein | 98.67 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 98.67 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 98.64 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 98.64 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 98.48 | |
| 3ca7_A | 52 | Protein spitz; argos, EGF, developmental protein, | 98.45 | |
| 1dyk_A | 394 | Laminin alpha 2 chain; metal binding protein; 2.0A | 98.45 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 98.42 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 98.41 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 98.41 | |
| 1egf_A | 53 | Epidermal growth factor; NMR {Mus musculus} SCOP: | 98.4 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 98.39 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 98.36 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 98.34 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 98.33 | |
| 1a3p_A | 45 | Epidermal growth factor; disulfide connectivities, | 98.31 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 98.27 | |
| 1h30_A | 422 | GAS6, growth-arrest-specific protein; laminin G-do | 98.26 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 98.23 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 98.23 | |
| 1hae_A | 63 | Heregulin-alpha; growth factor; NMR {Homo sapiens} | 98.18 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 98.08 | |
| 2p28_B | 217 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 98.06 | |
| 1nql_B | 53 | Epidermal growth factor; cell surface receptor, ty | 98.05 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 98.04 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 98.0 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 97.98 | |
| 2k2s_B | 61 | Micronemal protein 6; microneme protein complex, c | 97.96 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 97.91 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 97.9 | |
| 3ca7_A | 52 | Protein spitz; argos, EGF, developmental protein, | 97.88 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 97.87 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 97.83 | |
| 1k36_A | 46 | Epiregulin; EGF-like fold, hormone/growth factor c | 97.83 | |
| 3u7u_G | 55 | Neuregulin 1; signaling protein, transferase-trans | 97.83 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 97.73 | |
| 1a3p_A | 45 | Epidermal growth factor; disulfide connectivities, | 97.7 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 97.68 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 97.62 | |
| 1egf_A | 53 | Epidermal growth factor; NMR {Mus musculus} SCOP: | 97.61 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 97.6 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 97.59 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 97.58 | |
| 3ltf_D | 58 | Protein spitz; receptor-ligand complex ectodomain | 97.57 | |
| 1hae_A | 63 | Heregulin-alpha; growth factor; NMR {Homo sapiens} | 97.57 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 97.56 | |
| 1nql_B | 53 | Epidermal growth factor; cell surface receptor, ty | 97.46 | |
| 1q4g_A | 553 | Prostaglandin G/H synthase 1; cyclooxygenase, non- | 97.39 | |
| 1g1s_A | 162 | P-selectin; selectin, lectin, EGF, sulphated, SLEX | 97.38 | |
| 3nt1_A | 587 | Prostaglandin-endoperoxide synthase 2; prostagland | 97.33 | |
| 2fd6_A | 122 | Urokinase-type plasminogen activator; UPAR, ATF, A | 97.23 | |
| 2k2s_B | 61 | Micronemal protein 6; microneme protein complex, c | 96.97 | |
| 2ygo_A | 188 | WIF-1, WNT inhibitory factor 1; signaling protein, | 96.96 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 96.96 | |
| 1k36_A | 46 | Epiregulin; EGF-like fold, hormone/growth factor c | 96.89 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 96.89 | |
| 1g1t_A | 157 | E-selectin; EGF, adhesion molecule, SLEX, immune s | 96.83 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 96.7 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 96.69 | |
| 3e50_C | 50 | Protransforming growth factor alpha; IDE, TGF-alph | 96.67 | |
| 1apq_A | 53 | Complement protease C1R; EGF, calcium binding, ser | 96.62 | |
| 2fd6_A | 122 | Urokinase-type plasminogen activator; UPAR, ATF, A | 96.52 | |
| 2p28_B | 217 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 96.52 | |
| 3ltf_D | 58 | Protein spitz; receptor-ligand complex ectodomain | 96.44 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 96.41 | |
| 2rnl_A | 50 | Amphiregulin; AR, colorectum cell-derived growth f | 96.33 | |
| 3cfw_A | 164 | L-selectin; EGF, cell adhesion, EGF-like domain, g | 96.33 | |
| 2jkh_L | 55 | Factor X light chain; plasma, calcium, zymogen, se | 96.29 | |
| 1iox_A | 50 | Betacellulin; EGF-like fold, hormone/growth factor | 96.26 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 96.09 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 96.07 | |
| 1xdt_R | 79 | Hbegf, heparin-binding epidermal growth factor; co | 96.06 | |
| 3e50_C | 50 | Protransforming growth factor alpha; IDE, TGF-alph | 96.01 | |
| 1gl4_A | 285 | Nidogen-1, entactin; immunoglobulin-like domain, e | 95.97 | |
| 1szb_A | 170 | Mannose binding lectin-associated serine protease- | 95.85 | |
| 1iox_A | 50 | Betacellulin; EGF-like fold, hormone/growth factor | 95.82 | |
| 2i9a_A | 145 | Urokinase-type plasminogen activator; growth facto | 95.77 | |
| 2i9a_A | 145 | Urokinase-type plasminogen activator; growth facto | 95.75 | |
| 1g1s_A | 162 | P-selectin; selectin, lectin, EGF, sulphated, SLEX | 95.71 | |
| 1kli_L | 69 | Factor VIIA; extrinsic coagulation pathway, serine | 95.2 | |
| 2rnl_A | 50 | Amphiregulin; AR, colorectum cell-derived growth f | 95.15 | |
| 1kig_L | 51 | Factor XA; glycoprotein, serine protease, plasma, | 94.56 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 94.5 | |
| 2kl7_A | 71 | Fibulin-4; secreted, calcium, disease mutation, di | 94.36 | |
| 2jkh_L | 55 | Factor X light chain; plasma, calcium, zymogen, se | 93.57 | |
| 1q4g_A | 553 | Prostaglandin G/H synthase 1; cyclooxygenase, non- | 93.46 | |
| 2bz6_L | 53 | Blood coagulation factor VIIA; serine protease, en | 92.89 | |
| 2wph_E | 59 | Coagulation factor IXA light chain; serine proteas | 92.88 | |
| 2ygo_A | 188 | WIF-1, WNT inhibitory factor 1; signaling protein, | 92.83 | |
| 1apq_A | 53 | Complement protease C1R; EGF, calcium binding, ser | 92.58 | |
| 1nzi_A | 159 | Complement C1S component; calcium, innate immunity | 92.49 | |
| 1xdt_R | 79 | Hbegf, heparin-binding epidermal growth factor; co | 92.32 | |
| 4aqt_A | 375 | Laminin subunit gamma-1; cell adhesion; HET: NAG B | 92.08 | |
| 3v64_C | 349 | Agrin; beta propeller, laminin-G, signaling, prote | 91.97 | |
| 1ob1_C | 99 | Major merozoite surface protein; immune system, im | 91.9 | |
| 3nt1_A | 587 | Prostaglandin-endoperoxide synthase 2; prostagland | 91.69 | |
| 1g1t_A | 157 | E-selectin; EGF, adhesion molecule, SLEX, immune s | 91.6 | |
| 2wph_E | 59 | Coagulation factor IXA light chain; serine proteas | 91.47 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 91.22 | |
| 3cfw_A | 164 | L-selectin; EGF, cell adhesion, EGF-like domain, g | 91.04 | |
| 1kli_L | 69 | Factor VIIA; extrinsic coagulation pathway, serine | 89.99 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 89.66 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 89.34 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 88.96 | |
| 2e26_A | 725 | Reelin, reeler protein; signaling protein; HET: NA | 87.67 | |
| 1ob1_C | 99 | Major merozoite surface protein; immune system, im | 87.34 | |
| 1n1i_A | 105 | Merozoite surface protein-1; MSP1, malaria, surfac | 87.34 | |
| 2p26_A | 280 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 83.98 | |
| 1gl4_A | 285 | Nidogen-1, entactin; immunoglobulin-like domain, e | 82.13 |
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* | Back alignment and structure |
|---|
Probab=99.62 E-value=5e-16 Score=111.95 Aligned_cols=82 Identities=16% Similarity=0.346 Sum_probs=72.9
Q ss_pred CCcee-cCCCCccCCCCcceeec---------CC--ccCCCCceeeCCCCCCCCcccccCCCCCCC-CCCCCCcEEeeCC
Q psy2060 23 QPYLS-GLPDNEGLEKRVQTFVD---------GG--HRTLDLLHDMGARYHWGDTCETDITKSDCK-GVCSPGATCSLNP 89 (193)
Q Consensus 23 ~~~~c-C~~g~~g~~~~c~~~~~---------gg--~~~~~~~~C~C~~g~~G~~C~~~~~~~~C~-~pC~~gg~C~~~~ 89 (193)
+.|.| |++||+|.. |++++| +| .+..++|.|.|++||+|..|+..++ +|. .||.++++|++..
T Consensus 26 g~~~C~C~~Gy~G~~--C~~~~~~C~~~~C~~~~~C~~~~g~~~C~C~~G~~G~~C~~~~~--~C~~~~C~~~g~C~~~~ 101 (135)
T 2vj3_A 26 GSFECQCLQGYTGPR--CEIDVNECVSNPCQNDATCLDQIGEFQCICMPGYEGVHCEVNTD--ECASSPCLHNGRCLDKI 101 (135)
T ss_dssp SSEEEECCTTEESTT--SCEECCTTTTCCCCSSCEEEECSSCEEEECCTTEESSSSCEECC--TTTTCCSTTTCEEEECS
T ss_pred CCEEEECCCCCcCCc--ccccCccCCCCCCCCCCEEeCCCCCceeeCCCCCcCCcceecCC--cccCCCcCCCCEeECCC
Confidence 56889 999999997 987765 34 6778899999999999999998876 999 9999999999987
Q ss_pred CCceecccCCCCCCcccccccccee
Q psy2060 90 SGGYICDDCSLAGSYEHYDRLCRLR 114 (193)
Q Consensus 90 ~~~~~C~~C~~g~~~~~~g~~C~~~ 114 (193)
++|+|. |++||. |..|+..
T Consensus 102 -g~~~C~-C~~G~~----G~~C~~~ 120 (135)
T 2vj3_A 102 -NEFQCE-CPTGFT----GHLCQVD 120 (135)
T ss_dssp -SCEEEE-CCTTEE----SSSSCEE
T ss_pred -CCeEEE-CCCCCc----CCccCcc
Confidence 999999 999998 9999764
|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A | Back alignment and structure |
|---|
| >1pz7_A Agrin; structural protein; 1.42A {Gallus gallus} SCOP: b.29.1.4 PDB: 1pz8_A 1pz9_A 1q56_A | Back alignment and structure |
|---|
| >1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* | Back alignment and structure |
|---|
| >3pve_A Agrin, AGRN protein; mRNA splicing, structural genomics, PSI-2, protein structure initiative; 1.40A {Mus musculus} | Back alignment and structure |
|---|
| >3v64_A Low-density lipoprotein receptor-related protein; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} PDB: 3v65_A | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A | Back alignment and structure |
|---|
| >2r16_A Neurexin-1-alpha; beta-sandwich, cell adhesion, splicing; 1.04A {Bos taurus} | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A | Back alignment and structure |
|---|
| >1d2s_A SHBG, sex hormone-binding globulin; steroid transport, laminin G-like domain, jellyroll, androgen binding protein (ABP); HET: DHT; 1.55A {Homo sapiens} SCOP: b.29.1.4 PDB: 1kdk_A* 1kdm_A* | Back alignment and structure |
|---|
| >3sh4_A LG3 peptide; actin disassambly, integrin alpha12 BETA1, metal binding Pro; 1.50A {Homo sapiens} PDB: 3sh5_A | Back alignment and structure |
|---|
| >3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* | Back alignment and structure |
|---|
| >3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} | Back alignment and structure |
|---|
| >1f5f_A SHBG, sex hormone-binding globulin; jellyroll, signaling protein; HET: DHT; 1.70A {Homo sapiens} SCOP: b.29.1.4 PDB: 1lhw_A* 1lho_A* 1lhn_A* 1lhv_A* 1lhu_A* | Back alignment and structure |
|---|
| >2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} | Back alignment and structure |
|---|
| >2r1b_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 1.72A {Rattus norvegicus} PDB: 3mw2_A* 3b3q_E* 3mw3_A* | Back alignment and structure |
|---|
| >2h0b_A Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A {Bos taurus} | Back alignment and structure |
|---|
| >3bod_A Neurexin-1-alpha; neurexin1D, LNS6, alternative splicing, calcium, cell adhesion, EGF-like domain, glycoprotein, membrane, metal- binding; 1.70A {Mus musculus} PDB: 2vh8_C 2xb6_C* 2wqz_C* 1c4r_A 3bop_A 3mw4_A* | Back alignment and structure |
|---|
| >2r1d_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 2.60A {Rattus norvegicus} SCOP: b.29.1.4 PDB: 3biw_E* | Back alignment and structure |
|---|
| >4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* | Back alignment and structure |
|---|
| >1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... | Back alignment and structure |
|---|
| >2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... | Back alignment and structure |
|---|
| >4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D | Back alignment and structure |
|---|
| >1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* | Back alignment and structure |
|---|
| >1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* | Back alignment and structure |
|---|
| >1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A | Back alignment and structure |
|---|
| >1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* | Back alignment and structure |
|---|
| >1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... | Back alignment and structure |
|---|
| >2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A | Back alignment and structure |
|---|
| >1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* | Back alignment and structure |
|---|
| >3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} | Back alignment and structure |
|---|
| >1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A | Back alignment and structure |
|---|
| >3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A | Back alignment and structure |
|---|
| >1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* | Back alignment and structure |
|---|
| >1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... | Back alignment and structure |
|---|
| >1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A | Back alignment and structure |
|---|
| >3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... | Back alignment and structure |
|---|
| >2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A | Back alignment and structure |
|---|
| >2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A | Back alignment and structure |
|---|
| >2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A | Back alignment and structure |
|---|
| >3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A | Back alignment and structure |
|---|
| >1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A | Back alignment and structure |
|---|
| >2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A | Back alignment and structure |
|---|
| >3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} | Back alignment and structure |
|---|
| >2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... | Back alignment and structure |
|---|
| >1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A | Back alignment and structure |
|---|
| >1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A | Back alignment and structure |
|---|
| >1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A | Back alignment and structure |
|---|
| >2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* | Back alignment and structure |
|---|
| >2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* | Back alignment and structure |
|---|
| >1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A | Back alignment and structure |
|---|
| >1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* | Back alignment and structure |
|---|
| >2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... | Back alignment and structure |
|---|
| >1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... | Back alignment and structure |
|---|
| >2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* | Back alignment and structure |
|---|
| >2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* | Back alignment and structure |
|---|
| >2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* | Back alignment and structure |
|---|
| >1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} | Back alignment and structure |
|---|
| >3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A | Back alignment and structure |
|---|
| >3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... | Back alignment and structure |
|---|
| >1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A | Back alignment and structure |
|---|
| >2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* | Back alignment and structure |
|---|
| >1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A | Back alignment and structure |
|---|
| >1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 | Back alignment and structure |
|---|
| >2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* | Back alignment and structure |
|---|
| >1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 193 | ||||
| d1pz7a_ | 195 | b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxI | 3e-11 | |
| d1h30a1 | 191 | b.29.1.4 (A:261-451) Growth-arrest-specific protei | 2e-10 | |
| d1dyka1 | 189 | b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse | 8e-09 | |
| d1d2sa_ | 170 | b.29.1.4 (A:) Sex hormone-binding globulin {Human | 4e-08 | |
| d1dyka2 | 185 | b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse | 4e-07 | |
| d2r1da1 | 177 | b.29.1.4 (A:36-212) Ligand-binding domain of neure | 9e-05 | |
| d1h30a2 | 218 | b.29.1.4 (A:461-678) Growth-arrest-specific protei | 0.002 |
| >d1pz7a_ b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 195 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Concanavalin A-like lectins/glucanases superfamily: Concanavalin A-like lectins/glucanases family: Laminin G-like module domain: Agrin species: Chicken (Gallus gallus) [TaxId: 9031]
Score = 57.6 bits (138), Expect = 3e-11
Identities = 26/95 (27%), Positives = 41/95 (43%), Gaps = 6/95 (6%)
Query: 95 CDDCSLAG-SYEHYDRLCRLRARSFPKNSFLTFPALKQRNRLHIKLQFSTLHDSGLLLYN 153
+ + G +Y Y +S + P+ K H +L T GL+L++
Sbjct: 6 AEAIAFDGRTYMEYHNA---VTKSPDALDYPAEPSEKALQSNHFELSIKTEATQGLILWS 62
Query: 154 GRYNERHDFIALELTDSGRSVQFSWSLGSEVARLN 188
G+ ER D+IAL + D VQ + LGS+ L
Sbjct: 63 GKGLERSDYIALAIVDGF--VQMMYDLGSKPVVLR 95
|
| >d1h30a1 b.29.1.4 (A:261-451) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Length = 191 | Back information, alignment and structure |
|---|
| >d1dyka1 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 189 | Back information, alignment and structure |
|---|
| >d1d2sa_ b.29.1.4 (A:) Sex hormone-binding globulin {Human (Homo sapiens) [TaxId: 9606]} Length = 170 | Back information, alignment and structure |
|---|
| >d1dyka2 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 185 | Back information, alignment and structure |
|---|
| >d2r1da1 b.29.1.4 (A:36-212) Ligand-binding domain of neurexin 1beta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 177 | Back information, alignment and structure |
|---|
| >d1h30a2 b.29.1.4 (A:461-678) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Length = 218 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 193 | |||
| d1h30a1 | 191 | Growth-arrest-specific protein Gas6 {Human (Homo s | 99.29 | |
| d1pz7a_ | 195 | Agrin {Chicken (Gallus gallus) [TaxId: 9031]} | 99.15 | |
| d1dyka1 | 189 | Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: | 99.15 | |
| d1d2sa_ | 170 | Sex hormone-binding globulin {Human (Homo sapiens) | 98.98 | |
| d1edmb_ | 39 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 98.96 | |
| d1dyka2 | 185 | Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: | 98.96 | |
| d2vj3a2 | 39 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.96 | |
| d1xkba1 | 39 | Factor X, N-terminal module {Human (Homo sapiens) | 98.89 | |
| d2vj3a3 | 35 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.86 | |
| d2c4fl1 | 37 | Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | 98.82 | |
| d2r1da1 | 177 | Ligand-binding domain of neurexin 1beta {Rat (Ratt | 98.79 | |
| d2vj3a1 | 42 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.76 | |
| d1g1ta2 | 39 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 98.74 | |
| d1tpga1 | 41 | Plasminogen activator (tissue-type), t-PA {Human ( | 98.68 | |
| d1g1sa2 | 40 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 98.67 | |
| d1q4ga2 | 42 | Prostaglandin H2 synthase-1, EGF-like module {Shee | 98.62 | |
| d1autl1 | 48 | Activated protein c (autoprothrombin IIa) {Human ( | 98.59 | |
| d1cvua2 | 41 | Prostaglandin H2 synthase-1, EGF-like module {Mous | 98.56 | |
| d3egfa_ | 53 | Epidermal growth factor, EGF {Mouse (Mus musculus) | 98.26 | |
| d1haea_ | 63 | Heregulin-alpha, EGF-like domain {Human (Homo sapi | 98.16 | |
| d1nqlb_ | 48 | Epidermal growth factor, EGF {Human (Homo sapiens) | 98.15 | |
| d2vj3a2 | 39 | Neurogenic locus notch homolog protein 1, Notch1 { | 97.99 | |
| d1tpga1 | 41 | Plasminogen activator (tissue-type), t-PA {Human ( | 97.98 | |
| d1h30a2 | 218 | Growth-arrest-specific protein Gas6 {Human (Homo s | 97.98 | |
| d2vj3a1 | 42 | Neurogenic locus notch homolog protein 1, Notch1 { | 97.98 | |
| d1xkba1 | 39 | Factor X, N-terminal module {Human (Homo sapiens) | 97.95 | |
| d1edmb_ | 39 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 97.91 | |
| d1g1ta2 | 39 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 97.86 | |
| d2c4fl1 | 37 | Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | 97.84 | |
| d2vj3a3 | 35 | Neurogenic locus notch homolog protein 1, Notch1 { | 97.84 | |
| d1uzka2 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.82 | |
| d2i9aa1 | 40 | Plasminogen activator (urokinase-type) {Human (Hom | 97.74 | |
| d1g1sa2 | 40 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 97.74 | |
| d1emoa1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.71 | |
| d1ioxa_ | 50 | Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] | 97.7 | |
| d1lmja2 | 42 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.67 | |
| d1i0ua2 | 41 | Low density lipoprotein (LDL) receptor, different | 97.65 | |
| d3egfa_ | 53 | Epidermal growth factor, EGF {Mouse (Mus musculus) | 97.64 | |
| d1uzka1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.64 | |
| d1lmja1 | 44 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.63 | |
| d1haea_ | 63 | Heregulin-alpha, EGF-like domain {Human (Homo sapi | 97.52 | |
| d1apqa_ | 53 | Complement protease C1R {Human (Homo sapiens) [Tax | 97.49 | |
| d1nqlb_ | 48 | Epidermal growth factor, EGF {Human (Homo sapiens) | 97.42 | |
| d1autl1 | 48 | Activated protein c (autoprothrombin IIa) {Human ( | 97.39 | |
| d1moxc_ | 49 | Transforming growth factor alpha {Human (Homo sapi | 97.35 | |
| d1nt0a3 | 45 | Mannose-binding protein associated serine protease | 97.33 | |
| d1szba2 | 45 | Mannose-binding protein associated serine protease | 97.29 | |
| d1nzia2 | 42 | Complement C1S component {Human (Homo sapiens) [Ta | 97.23 | |
| d1k36a_ | 46 | Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI | 97.21 | |
| d1dx5i3 | 40 | Thrombomodulin, different EGF-like domains {Human | 97.19 | |
| d1gl4a2 | 40 | EGF-like domain of nidogen-1 {Mouse (Mus musculus) | 97.17 | |
| d1k36a_ | 46 | Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI | 97.08 | |
| d3bpse1 | 40 | Low density lipoprotein (LDL) receptor, different | 97.03 | |
| d1q4ga2 | 42 | Prostaglandin H2 synthase-1, EGF-like module {Shee | 97.03 | |
| d1ioxa_ | 50 | Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] | 96.97 | |
| d1moxc_ | 49 | Transforming growth factor alpha {Human (Homo sapi | 96.97 | |
| d1cvua2 | 41 | Prostaglandin H2 synthase-1, EGF-like module {Mous | 96.94 | |
| d1emoa2 | 39 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 96.88 | |
| d2i9aa1 | 40 | Plasminogen activator (urokinase-type) {Human (Hom | 96.65 | |
| d1uzka2 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 96.28 | |
| d1apqa_ | 53 | Complement protease C1R {Human (Homo sapiens) [Tax | 95.81 | |
| d1emoa1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 95.77 | |
| d1dx5i3 | 40 | Thrombomodulin, different EGF-like domains {Human | 95.7 | |
| d1gl4a2 | 40 | EGF-like domain of nidogen-1 {Mouse (Mus musculus) | 95.68 | |
| d1lmja2 | 42 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 95.64 | |
| d1i0ua2 | 41 | Low density lipoprotein (LDL) receptor, different | 95.49 | |
| d1nzia2 | 42 | Complement C1S component {Human (Homo sapiens) [Ta | 95.44 | |
| d1lmja1 | 44 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 95.11 | |
| d1xdtr_ | 41 | Heparin-binding epidermal growth factor, HBEGF {Hu | 95.02 | |
| d1nt0a3 | 45 | Mannose-binding protein associated serine protease | 95.01 | |
| d1uzka1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 94.93 | |
| d3bpse1 | 40 | Low density lipoprotein (LDL) receptor, different | 94.9 | |
| d1xdtr_ | 41 | Heparin-binding epidermal growth factor, HBEGF {Hu | 94.83 | |
| d1autl2 | 50 | Activated protein c (autoprothrombin IIa) {Human ( | 94.77 | |
| d1szba2 | 45 | Mannose-binding protein associated serine protease | 94.77 | |
| d2p3ua1 | 51 | Factor X, N-terminal module {Human (Homo sapiens) | 94.35 | |
| d1kloa1 | 55 | Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: | 94.34 | |
| d1autl2 | 50 | Activated protein c (autoprothrombin IIa) {Human ( | 93.91 | |
| d1kigl_ | 51 | Factor X, N-terminal module {Cow (Bos taurus) [Tax | 93.11 | |
| d2p3ua1 | 51 | Factor X, N-terminal module {Human (Homo sapiens) | 92.66 | |
| d1kloa1 | 55 | Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: | 91.61 | |
| d1rfnb_ | 57 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 91.27 | |
| d1ijqa2 | 50 | Low density lipoprotein (LDL) receptor, different | 91.13 | |
| d2bz6l1 | 53 | Coagulation factor VIIa {Human (Homo sapiens) [Tax | 90.24 | |
| d1ijqa2 | 50 | Low density lipoprotein (LDL) receptor, different | 89.51 | |
| d1l3ya_ | 41 | Integrin beta EGF-like domains {Human (Homo sapien | 88.84 | |
| d1dx5i1 | 43 | Thrombomodulin, different EGF-like domains {Human | 86.17 | |
| d1jv2b4 | 31 | Integrin beta EGF-like domains {Human (Homo sapien | 81.02 |
| >d1h30a1 b.29.1.4 (A:261-451) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Concanavalin A-like lectins/glucanases superfamily: Concanavalin A-like lectins/glucanases family: Laminin G-like module domain: Growth-arrest-specific protein Gas6 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.29 E-value=5.6e-12 Score=93.69 Aligned_cols=73 Identities=22% Similarity=0.375 Sum_probs=53.9
Q ss_pred ccCCCc--ceEEecCCCCCceeEEEEEEEeCCCCeEEEEeecCCCCCceEEEEecCCeeEEEEEEeCCCceEEEEcCCC
Q psy2060 116 RSFPKN--SFLTFPALKQRNRLHIKLQFSTLHDSGLLLYNGRYNERHDFIALELTDSGRSVQFSWSLGSEVARLNRADS 192 (193)
Q Consensus 116 ~sF~g~--syl~~~~~~~~~~~~i~~~f~T~~~~glLl~~g~~~~~~dfi~l~l~~G~~~l~~~~~~g~g~~~l~s~~~ 192 (193)
.+|.+. +|+.++... ...++|+|.|||..++|+|||.+. ....||++|+|.+|+ |++++++|++..++++...
T Consensus 39 ~~f~g~~~~~~~~~~~~-~~~~~i~~~FrT~~~~GlL~~~~~-~~~~~fi~l~l~~G~--l~~~~~~g~~~~~~~~~~~ 113 (191)
T d1h30a1 39 RMFSGTPVIRLRFKRLQ-PTRLVAEFDFRTFDPEGILLFAGG-HQDSTWIVLALRAGR--LELQLRYNGVGRVTSSGPV 113 (191)
T ss_dssp C-----CCEEEECCBSS-CCCCEEEEEEEECCSSEEEEEEES-CTTSEEEEEEEETTE--EEEEEEETTEEEEEEEEEE
T ss_pred cccCCCceEEEEeccCC-CCceEEEEEEEeCCCCeEEEEEcC-CCCCcEEEEEEECCE--EEEEEEcCCCcEEecCCcc
Confidence 356654 444454333 344689999999999999999864 446799999999999 9999999999888877543
|
| >d1pz7a_ b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1dyka1 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1d2sa_ b.29.1.4 (A:) Sex hormone-binding globulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dyka2 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2r1da1 b.29.1.4 (A:36-212) Ligand-binding domain of neurexin 1beta {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h30a2 b.29.1.4 (A:461-678) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dx5i1 g.3.11.1 (I:345-387) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|