Diaphorina citri psyllid: psy2068


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------
MLFSYQKNWMSDSYLAQLTIDYSFVCRMKWKQANVFKRHGLEPINPLGEKFDPNFHEALFEQEVEGKEANTVVVVSKIGYKLYNRVIRPALVGISKS
cccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEccccccccccHHHHHEEcccccccccEEEEEEEccEEEccEEEcccEEEEEcc
*LFSYQKNWMSDSYLAQLTIDYSFVCRMKWKQANVFKRHGLEPINPLGEKFDPNFHEALFEQEVEGKEANTVVVVSKIGYKLYNRVIRPALVGISKS
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLFSYQKNWMSDSYLAQLTIDYSFVCRMKWKQANVFKRHGLEPINPLGEKFDPNFHEALFEQEVEGKEANTVVVVSKIGYKLYNRVIRPALVGISKS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
GrpE protein homolog 1, mitochondrial Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. Seems to control the nucleotide-dependent binding of mitochondrial HSP70 to substrate proteins.confidentQ99LP6
GrpE protein homolog, mitochondrial Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. Seems to control the nucleotide-dependent binding of SSC1 to substrate proteins.confidentQ6BTP9
GrpE protein homolog 1, mitochondrial Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. Seems to control the nucleotide-dependent binding of mitochondrial HSP70 to substrate proteins.confidentQ5RA81

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0001405 [CC]presequence translocase-associated import motorprobableGO:0044464, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0044455, GO:0031967, GO:0031966, GO:0043234, GO:0032991, GO:0043231, GO:0019866, GO:0005623, GO:0005622, GO:0044446, GO:0005743, GO:0044444, GO:0044429, GO:0005744, GO:0044424, GO:0044425, GO:0044422
GO:0051082 [MF]unfolded protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0005759 [CC]mitochondrial matrixprobableGO:0005737, GO:0005575, GO:0043231, GO:0043233, GO:0031974, GO:0044464, GO:0043229, GO:0005739, GO:0005622, GO:0044446, GO:0070013, GO:0044444, GO:0044429, GO:0044424, GO:0005623, GO:0043227, GO:0043226, GO:0044422
GO:0042026 [BP]protein refoldingprobableGO:0044267, GO:0006457, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4ANI, chain A
Confidence level:very confident
Coverage over the Query: 18-96
View the alignment between query and template
View the model in PyMOL