Psyllid ID: psy2068


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------
MLFSYQKNWMSDSYLAQLTIDYSFVCRMKWKQANVFKRHGLEPINPLGEKFDPNFHEALFEQEVEGKEANTVVVVSKIGYKLYNRVIRPALVGISKS
cccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEccccccccccHHHHHEEcccccccccEEEEEEEccEEEccEEEcccEEEEEcc
ccccccHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccEEEccccccccccHcEEEEEccccccccccEEEEEEEcEEEcccEEEEEEEEEEcc
mlfsyqknwmsdsYLAQLTIDYSFVCRMKWKQANVFkrhglepinplgekfdpnfHEALFEQevegkeanTVVVVSKIGYKLYNRVIRPalvgisks
mlfsyqknwmsdsyLAQLTIDYSFVCRMKWKQANVFKRHGLEPINPLGEKFDPNFHEALFEqevegkeantVVVVSKigyklynrvirpalvgisks
MLFSYQKNWMSDSYLAQLTIDYSFVCRMKWKQANVFKRHGLEPINPLGEKFDPNFHEALFEQEVEGKEANTVVVVSKIGYKLYNRVIRPALVGISKS
****YQKNWMSDSYLAQLTIDYSFVCRMKWKQANVFKRHGLEPINPLGEKFDPNFHEALFEQEVEGKEANTVVVVSKIGYKLYNRVIRPALVGI***
*LFSYQKNWMSDSYLAQLTIDYSFVCRMKWKQANVFKRHGLEPINPLGEKFDPNFHEALFEQEVEGKEANTVVVVSKIGYKLYNRVIRPALVGISKS
MLFSYQKNWMSDSYLAQLTIDYSFVCRMKWKQANVFKRHGLEPINPLGEKFDPNFHEALFEQEVEGKEANTVVVVSKIGYKLYNRVIRPALVGISKS
****YQK****DSYLAQLTIDYSFVCRMKWKQANVFKRHGLEPINPLGEKFDPNFHEALFEQEVEGKEANTVVVVSKIGYKLYNRVIRPALVGISKS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLFSYQKNWMSDSYLAQLTIDYSFVCRMKWKQANVFKRHGLEPINPLGEKFDPNFHEALFEQEVEGKEANTVVVVSKIGYKLYNRVIRPALVGISKS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query97 2.2.26 [Sep-21-2011]
P48604213 GrpE protein homolog, mit yes N/A 0.639 0.291 0.677 3e-20
Q5RA81217 GrpE protein homolog 1, m yes N/A 0.639 0.285 0.629 5e-17
Q9HAV7217 GrpE protein homolog 1, m yes N/A 0.639 0.285 0.629 5e-17
Q3SZC1217 GrpE protein homolog 1, m yes N/A 0.649 0.290 0.619 6e-17
Q99LP6217 GrpE protein homolog 1, m yes N/A 0.649 0.290 0.603 1e-16
P97576217 GrpE protein homolog 1, m yes N/A 0.649 0.290 0.603 2e-16
Q6CRQ1243 GrpE protein homolog, mit yes N/A 0.639 0.255 0.580 6e-14
P38523228 GrpE protein homolog, mit yes N/A 0.649 0.276 0.539 2e-13
A6WVA7228 Protein GrpE OS=Ochrobact yes N/A 0.639 0.271 0.516 8e-13
Q5GSA3182 Protein GrpE OS=Wolbachia yes N/A 0.649 0.346 0.492 1e-12
>sp|P48604|GRPE_DROME GrpE protein homolog, mitochondrial OS=Drosophila melanogaster GN=Roe1 PE=2 SV=2 Back     alignment and function desciption
 Score = 97.4 bits (241), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 42/62 (67%), Positives = 53/62 (85%)

Query: 35  VFKRHGLEPINPLGEKFDPNFHEALFEQEVEGKEANTVVVVSKIGYKLYNRVIRPALVGI 94
           VFKRHGLEP++P+ +KFDPN HEALF++E +  E NTVV V+K+GYKL+ R IRPALVG+
Sbjct: 151 VFKRHGLEPLDPINQKFDPNQHEALFQKEDKTVEPNTVVEVTKLGYKLHERCIRPALVGV 210

Query: 95  SK 96
           SK
Sbjct: 211 SK 212




Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. Seems to control the nucleotide-dependent binding of mitochondrial HSP70 to substrate proteins.
Drosophila melanogaster (taxid: 7227)
>sp|Q5RA81|GRPE1_PONAB GrpE protein homolog 1, mitochondrial OS=Pongo abelii GN=GRPEL1 PE=2 SV=1 Back     alignment and function description
>sp|Q9HAV7|GRPE1_HUMAN GrpE protein homolog 1, mitochondrial OS=Homo sapiens GN=GRPEL1 PE=1 SV=2 Back     alignment and function description
>sp|Q3SZC1|GRPE1_BOVIN GrpE protein homolog 1, mitochondrial OS=Bos taurus GN=GRPEL1 PE=1 SV=1 Back     alignment and function description
>sp|Q99LP6|GRPE1_MOUSE GrpE protein homolog 1, mitochondrial OS=Mus musculus GN=Grpel1 PE=1 SV=1 Back     alignment and function description
>sp|P97576|GRPE1_RAT GrpE protein homolog 1, mitochondrial OS=Rattus norvegicus GN=Grpel1 PE=1 SV=2 Back     alignment and function description
>sp|Q6CRQ1|GRPE_KLULA GrpE protein homolog, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=mge1 PE=3 SV=1 Back     alignment and function description
>sp|P38523|GRPE_YEAST GrpE protein homolog, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MGE1 PE=1 SV=1 Back     alignment and function description
>sp|A6WVA7|GRPE_OCHA4 Protein GrpE OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=grpE PE=3 SV=1 Back     alignment and function description
>sp|Q5GSA3|GRPE_WOLTR Protein GrpE OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=grpE PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query97
242010313 239 grpe protein, putative [Pediculus humanu 0.659 0.267 0.828 9e-25
332374942 218 unknown [Dendroctonus ponderosae] 0.773 0.344 0.706 2e-24
91093058 222 PREDICTED: similar to GrpE-like 1, mitoc 0.773 0.337 0.68 3e-23
312375535160 hypothetical protein AND_14051 [Anophele 0.721 0.437 0.718 4e-22
157106034 226 hypothetical protein AaeL_AAEL004438 [Ae 0.773 0.331 0.666 1e-21
170043539 221 grpE [Culex quinquefasciatus] gi|1678668 0.896 0.393 0.608 2e-21
158287473 221 AGAP011150-PA [Anopheles gambiae str. PE 0.711 0.312 0.7 7e-21
340725766 235 PREDICTED: grpE protein homolog, mitocho 0.639 0.263 0.741 1e-20
328780331 237 PREDICTED: grpE protein homolog, mitocho 0.639 0.261 0.741 1e-20
350397263 270 PREDICTED: grpE protein homolog, mitocho 0.639 0.229 0.741 2e-20
>gi|242010313|ref|XP_002425913.1| grpe protein, putative [Pediculus humanus corporis] gi|212509889|gb|EEB13175.1| grpe protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  117 bits (293), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 53/64 (82%), Positives = 59/64 (92%)

Query: 34  NVFKRHGLEPINPLGEKFDPNFHEALFEQEVEGKEANTVVVVSKIGYKLYNRVIRPALVG 93
           NVF+RHGL P+NPL EKFDPN HEALF+QEVEGKEA T+VVVSKIGYKL+ RVIRPALVG
Sbjct: 174 NVFRRHGLVPVNPLNEKFDPNLHEALFQQEVEGKEAGTIVVVSKIGYKLHERVIRPALVG 233

Query: 94  ISKS 97
           I+KS
Sbjct: 234 IAKS 237




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|332374942|gb|AEE62612.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|91093058|ref|XP_967697.1| PREDICTED: similar to GrpE-like 1, mitochondrial [Tribolium castaneum] gi|270002666|gb|EEZ99113.1| hypothetical protein TcasGA2_TC005006 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|312375535|gb|EFR22892.1| hypothetical protein AND_14051 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|157106034|ref|XP_001649137.1| hypothetical protein AaeL_AAEL004438 [Aedes aegypti] gi|108879963|gb|EAT44188.1| AAEL004438-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|170043539|ref|XP_001849441.1| grpE [Culex quinquefasciatus] gi|167866847|gb|EDS30230.1| grpE [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|158287473|ref|XP_309497.4| AGAP011150-PA [Anopheles gambiae str. PEST] gi|157019667|gb|EAA05028.4| AGAP011150-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|340725766|ref|XP_003401237.1| PREDICTED: grpE protein homolog, mitochondrial-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|328780331|ref|XP_624159.2| PREDICTED: grpE protein homolog, mitochondrial [Apis mellifera] Back     alignment and taxonomy information
>gi|350397263|ref|XP_003484824.1| PREDICTED: grpE protein homolog, mitochondrial-like [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query97
FB|FBgn0014877213 Roe1 "Roe1" [Drosophila melano 0.639 0.291 0.677 6.5e-19
UNIPROTKB|Q5ZHV6222 GRPEL1 "GrpE protein homolog" 0.639 0.279 0.629 5.3e-17
UNIPROTKB|Q9HAV7217 GRPEL1 "GrpE protein homolog 1 0.639 0.285 0.629 8.6e-17
UNIPROTKB|Q3SZC1217 GRPEL1 "GrpE protein homolog 1 0.639 0.285 0.629 1.1e-16
UNIPROTKB|E2RAZ6230 GRPEL1 "Uncharacterized protei 0.639 0.269 0.612 2.3e-16
MGI|MGI:1334417217 Grpel1 "GrpE-like 1, mitochond 0.639 0.285 0.612 2.9e-16
RGD|70947217 Grpel1 "GrpE-like 1, mitochond 0.639 0.285 0.612 2.9e-16
UNIPROTKB|I3LVG4217 LOC100622145 "GrpE protein hom 0.639 0.285 0.612 3.7e-16
ZFIN|ZDB-GENE-051120-111217 grpel1 "GrpE-like 1, mitochond 0.649 0.290 0.555 9.8e-16
SGD|S000005758228 MGE1 "Mitochondrial matrix coc 0.649 0.276 0.539 4.4e-13
FB|FBgn0014877 Roe1 "Roe1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 227 (85.0 bits), Expect = 6.5e-19, P = 6.5e-19
 Identities = 42/62 (67%), Positives = 53/62 (85%)

Query:    35 VFKRHGLEPINPLGEKFDPNFHEALFEQEVEGKEANTVVVVSKIGYKLYNRVIRPALVGI 94
             VFKRHGLEP++P+ +KFDPN HEALF++E +  E NTVV V+K+GYKL+ R IRPALVG+
Sbjct:   151 VFKRHGLEPLDPINQKFDPNQHEALFQKEDKTVEPNTVVEVTKLGYKLHERCIRPALVGV 210

Query:    95 SK 96
             SK
Sbjct:   211 SK 212




GO:0051082 "unfolded protein binding" evidence=ISS
GO:0005739 "mitochondrion" evidence=ISS;NAS
GO:0006457 "protein folding" evidence=ISS;NAS
GO:0005759 "mitochondrial matrix" evidence=ISS;NAS
GO:0006626 "protein targeting to mitochondrion" evidence=ISS;NAS
GO:0000774 "adenyl-nucleotide exchange factor activity" evidence=IEA
GO:0051087 "chaperone binding" evidence=IEA
GO:0042803 "protein homodimerization activity" evidence=IEA
GO:0022008 "neurogenesis" evidence=IMP
UNIPROTKB|Q5ZHV6 GRPEL1 "GrpE protein homolog" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q9HAV7 GRPEL1 "GrpE protein homolog 1, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q3SZC1 GRPEL1 "GrpE protein homolog 1, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RAZ6 GRPEL1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1334417 Grpel1 "GrpE-like 1, mitochondrial" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|70947 Grpel1 "GrpE-like 1, mitochondrial" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|I3LVG4 LOC100622145 "GrpE protein homolog" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-051120-111 grpel1 "GrpE-like 1, mitochondrial" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
SGD|S000005758 MGE1 "Mitochondrial matrix cochaperone" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q99LP6GRPE1_MOUSENo assigned EC number0.60310.64940.2903yesN/A
Q5RA81GRPE1_PONABNo assigned EC number0.62900.63910.2857yesN/A
Q6FPH2GRPE_CANGANo assigned EC number0.53220.63910.2683yesN/A
P48604GRPE_DROMENo assigned EC number0.67740.63910.2910yesN/A
P97576GRPE1_RATNo assigned EC number0.60310.64940.2903yesN/A
Q54QF9GRPE_DICDINo assigned EC number0.51610.63910.2910yesN/A
P38523GRPE_YEASTNo assigned EC number0.53960.64940.2763yesN/A
Q3SZC1GRPE1_BOVINNo assigned EC number0.61900.64940.2903yesN/A
Q6BTP9GRPE_DEBHANo assigned EC number0.51470.65970.2633yesN/A
Q3SIN5GRPE_THIDANo assigned EC number0.52380.61850.3468yesN/A
Q9HAV7GRPE1_HUMANNo assigned EC number0.62900.63910.2857yesN/A
Q6CRQ1GRPE_KLULANo assigned EC number0.58060.63910.2551yesN/A
Q75C01GRPE_ASHGONo assigned EC number0.51660.61850.2830yesN/A
A6WVA7GRPE_OCHA4No assigned EC number0.51610.63910.2719yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query97
cd00446137 cd00446, GrpE, GrpE is the adenine nucleotide exch 4e-29
pfam01025165 pfam01025, GrpE, GrpE 5e-28
COG0576193 COG0576, GrpE, Molecular chaperone GrpE (heat shoc 3e-26
PRK14141209 PRK14141, PRK14141, heat shock protein GrpE; Provi 5e-20
PRK14139185 PRK14139, PRK14139, heat shock protein GrpE; Provi 9e-18
PRK14150193 PRK14150, PRK14150, heat shock protein GrpE; Provi 4e-17
PRK14140191 PRK14140, PRK14140, heat shock protein GrpE; Provi 7e-17
PRK14151176 PRK14151, PRK14151, heat shock protein GrpE; Provi 7e-16
PRK14155208 PRK14155, PRK14155, heat shock protein GrpE; Provi 3e-14
PRK14153194 PRK14153, PRK14153, heat shock protein GrpE; Provi 2e-13
PRK14144199 PRK14144, PRK14144, heat shock protein GrpE; Provi 3e-13
PRK14149191 PRK14149, PRK14149, heat shock protein GrpE; Provi 7e-13
PRK14145196 PRK14145, PRK14145, heat shock protein GrpE; Provi 3e-11
PRK14147172 PRK14147, PRK14147, heat shock protein GrpE; Provi 7e-11
PRK14159176 PRK14159, PRK14159, heat shock protein GrpE; Provi 1e-10
PRK14158194 PRK14158, PRK14158, heat shock protein GrpE; Provi 1e-10
PRK14143238 PRK14143, PRK14143, heat shock protein GrpE; Provi 1e-10
PRK14162194 PRK14162, PRK14162, heat shock protein GrpE; Provi 2e-10
PRK14148195 PRK14148, PRK14148, heat shock protein GrpE; Provi 3e-10
PRK14161178 PRK14161, PRK14161, heat shock protein GrpE; Provi 1e-09
PRK14154208 PRK14154, PRK14154, heat shock protein GrpE; Provi 6e-09
PRK14163214 PRK14163, PRK14163, heat shock protein GrpE; Provi 2e-07
PRK14164218 PRK14164, PRK14164, heat shock protein GrpE; Provi 3e-07
PRK14157227 PRK14157, PRK14157, heat shock protein GrpE; Provi 3e-07
PRK14142223 PRK14142, PRK14142, heat shock protein GrpE; Provi 8e-07
PRK10325197 PRK10325, PRK10325, heat shock protein GrpE; Provi 1e-06
PRK14160211 PRK14160, PRK14160, heat shock protein GrpE; Provi 4e-06
PRK14156177 PRK14156, PRK14156, heat shock protein GrpE; Provi 5e-06
>gnl|CDD|238252 cd00446, GrpE, GrpE is the adenine nucleotide exchange factor of DnaK (Hsp70)-type ATPases Back     alignment and domain information
 Score =  101 bits (253), Expect = 4e-29
 Identities = 30/61 (49%), Positives = 41/61 (67%)

Query: 34  NVFKRHGLEPINPLGEKFDPNFHEALFEQEVEGKEANTVVVVSKIGYKLYNRVIRPALVG 93
           +V ++HG+E I P GE FDPN HEA+ +      E  TVV V + GYKL +RV+RPA+V 
Sbjct: 77  DVLEKHGVEKIEPEGEPFDPNLHEAVMQVPSPDVEPGTVVEVLQKGYKLGDRVLRPAMVV 136

Query: 94  I 94
           +
Sbjct: 137 V 137


The GrpE dimer binds to the ATPase domain of Hsp70 catalyzing the dissociation of ADP, which enables rebinding of ATP, one step in the Hsp70 reaction cycle in protein folding. In eukaryotes, only the mitochondrial Hsp70, not the cytosolic form, is GrpE dependent. Length = 137

>gnl|CDD|216249 pfam01025, GrpE, GrpE Back     alignment and domain information
>gnl|CDD|223649 COG0576, GrpE, Molecular chaperone GrpE (heat shock protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|172630 PRK14141, PRK14141, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|237621 PRK14139, PRK14139, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|184539 PRK14150, PRK14150, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|172640 PRK14151, PRK14151, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|237627 PRK14155, PRK14155, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|184540 PRK14153, PRK14153, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|184535 PRK14144, PRK14144, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|184538 PRK14149, PRK14149, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|184536 PRK14145, PRK14145, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|237625 PRK14147, PRK14147, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|172647 PRK14159, PRK14159, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|172646 PRK14158, PRK14158, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|237624 PRK14143, PRK14143, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|237631 PRK14162, PRK14162, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|172637 PRK14148, PRK14148, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|237630 PRK14161, PRK14161, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|237626 PRK14154, PRK14154, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|184546 PRK14163, PRK14163, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|237632 PRK14164, PRK14164, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|184543 PRK14157, PRK14157, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|237623 PRK14142, PRK14142, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|182379 PRK10325, PRK10325, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|237629 PRK14160, PRK14160, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|237628 PRK14156, PRK14156, heat shock protein GrpE; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 97
PRK14147172 heat shock protein GrpE; Provisional 99.97
PRK14148195 heat shock protein GrpE; Provisional 99.97
PRK14151176 heat shock protein GrpE; Provisional 99.97
COG0576193 GrpE Molecular chaperone GrpE (heat shock protein) 99.97
PRK14150193 heat shock protein GrpE; Provisional 99.97
PRK10325197 heat shock protein GrpE; Provisional 99.97
PRK14153194 heat shock protein GrpE; Provisional 99.97
PRK14161178 heat shock protein GrpE; Provisional 99.97
PRK14141209 heat shock protein GrpE; Provisional 99.97
PRK14140191 heat shock protein GrpE; Provisional 99.97
PRK14145196 heat shock protein GrpE; Provisional 99.97
PRK14155208 heat shock protein GrpE; Provisional 99.97
PRK14158194 heat shock protein GrpE; Provisional 99.97
PRK14144199 heat shock protein GrpE; Provisional 99.96
PRK14162194 heat shock protein GrpE; Provisional 99.96
PRK14139185 heat shock protein GrpE; Provisional 99.96
PRK14159176 heat shock protein GrpE; Provisional 99.96
PRK14163214 heat shock protein GrpE; Provisional 99.96
PRK14146215 heat shock protein GrpE; Provisional 99.96
PRK14149191 heat shock protein GrpE; Provisional 99.96
PRK14143238 heat shock protein GrpE; Provisional 99.96
PRK14154208 heat shock protein GrpE; Provisional 99.96
PRK14160211 heat shock protein GrpE; Provisional 99.96
PF01025165 GrpE: GrpE; InterPro: IPR000740 Molecular chaperon 99.96
PRK14157227 heat shock protein GrpE; Provisional 99.95
cd00446137 GrpE GrpE is the adenine nucleotide exchange facto 99.95
PRK14156177 heat shock protein GrpE; Provisional 99.94
PRK14142223 heat shock protein GrpE; Provisional 99.94
PRK14164218 heat shock protein GrpE; Provisional 99.93
KOG3003|consensus236 99.93
>PRK14147 heat shock protein GrpE; Provisional Back     alignment and domain information
Probab=99.97  E-value=2e-31  Score=191.79  Aligned_cols=80  Identities=31%  Similarity=0.441  Sum_probs=77.1

Q ss_pred             hhccHHHHHHHHHHHHHHHHhCCCeeeCCCCCCCCcccceeeeEeecCCCCCCeeEEEEecCeeeCCEEeeeceEEeecC
Q psy2068          18 LTIDYSFVCRMKWKQANVFKRHGLEPINPLGEKFDPNFHEALFEQEVEGKEANTVVVVSKIGYKLYNRVIRPALVGISKS   97 (97)
Q Consensus        18 ~~~~~~G~~~i~~~l~~~L~~~Gv~~i~~~G~~FDP~~HeAv~~~~~~~~~~gtV~~V~~~GY~~~~rvLRpA~V~V~k~   97 (97)
                      .+++.+|++||+++|.++|+++||++|+++|++|||++||||+++++++.++|+|++|+|+||+++|||||||+|+|+++
T Consensus        92 ~~~l~~Gv~mi~k~l~~~L~~~Gv~~i~~~G~~FDP~~HeAv~~~~~~~~~~g~Vv~v~qkGY~l~~RvLRpA~V~Vak~  171 (172)
T PRK14147         92 PSPLRDGLELTYKQLLKVAADNGLTLLDPVGQPFNPEHHQAISQGEAEGVAPGHVVQVFQKGYLLNERLLRPALVVVAKQ  171 (172)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCEEeCCCCCCCChHHhceeeeecCCCCCcCEEEEEeeCCcEeCCEeccCceEEeCCC
Confidence            46789999999999999999999999999999999999999999999999999999999999999999999999999984



>PRK14148 heat shock protein GrpE; Provisional Back     alignment and domain information
>PRK14151 heat shock protein GrpE; Provisional Back     alignment and domain information
>COG0576 GrpE Molecular chaperone GrpE (heat shock protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14150 heat shock protein GrpE; Provisional Back     alignment and domain information
>PRK10325 heat shock protein GrpE; Provisional Back     alignment and domain information
>PRK14153 heat shock protein GrpE; Provisional Back     alignment and domain information
>PRK14161 heat shock protein GrpE; Provisional Back     alignment and domain information
>PRK14141 heat shock protein GrpE; Provisional Back     alignment and domain information
>PRK14140 heat shock protein GrpE; Provisional Back     alignment and domain information
>PRK14145 heat shock protein GrpE; Provisional Back     alignment and domain information
>PRK14155 heat shock protein GrpE; Provisional Back     alignment and domain information
>PRK14158 heat shock protein GrpE; Provisional Back     alignment and domain information
>PRK14144 heat shock protein GrpE; Provisional Back     alignment and domain information
>PRK14162 heat shock protein GrpE; Provisional Back     alignment and domain information
>PRK14139 heat shock protein GrpE; Provisional Back     alignment and domain information
>PRK14159 heat shock protein GrpE; Provisional Back     alignment and domain information
>PRK14163 heat shock protein GrpE; Provisional Back     alignment and domain information
>PRK14146 heat shock protein GrpE; Provisional Back     alignment and domain information
>PRK14149 heat shock protein GrpE; Provisional Back     alignment and domain information
>PRK14143 heat shock protein GrpE; Provisional Back     alignment and domain information
>PRK14154 heat shock protein GrpE; Provisional Back     alignment and domain information
>PRK14160 heat shock protein GrpE; Provisional Back     alignment and domain information
>PF01025 GrpE: GrpE; InterPro: IPR000740 Molecular chaperones are a diverse family of proteins that function to protect proteins in the intracellular milieu from irreversible aggregation during synthesis and in times of cellular stress Back     alignment and domain information
>PRK14157 heat shock protein GrpE; Provisional Back     alignment and domain information
>cd00446 GrpE GrpE is the adenine nucleotide exchange factor of DnaK (Hsp70)-type ATPases Back     alignment and domain information
>PRK14156 heat shock protein GrpE; Provisional Back     alignment and domain information
>PRK14142 heat shock protein GrpE; Provisional Back     alignment and domain information
>PRK14164 heat shock protein GrpE; Provisional Back     alignment and domain information
>KOG3003|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query97
4ani_A213 Structural Basis For The Intermolecular Communicati 6e-12
>pdb|4ANI|A Chain A, Structural Basis For The Intermolecular Communication Between Dnak And Grpe In The Dnak Chaperone System From Geobacillus Kaustophilus Hta426 Length = 213 Back     alignment and structure

Iteration: 1

Score = 65.9 bits (159), Expect = 6e-12, Method: Compositional matrix adjust. Identities = 29/63 (46%), Positives = 43/63 (68%) Query: 34 NVFKRHGLEPINPLGEKFDPNFHEALFEQEVEGKEANTVVVVSKIGYKLYNRVIRPALVG 93 + K+ G+E I +G+ FDP H+A+ + E EG E NTVV + GYKL +RV+RPA+V Sbjct: 151 DALKKEGVEAIEAVGKPFDPYLHQAVMQAEAEGYEPNTVVEELQKGYKLKDRVLRPAMVK 210 Query: 94 ISK 96 +S+ Sbjct: 211 VSQ 213

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query97
1dkg_A197 Nucleotide exchange factor GRPE; HSP70, GRPE, nucl 1e-30
4ani_A213 Protein GRPE; chaperone cycle, complementary assay 6e-29
3a6m_A177 Protein GRPE, HSP-70 cofactor; coiled-coil, four-h 2e-24
>1dkg_A Nucleotide exchange factor GRPE; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: b.73.1.1 h.1.9.1 Length = 197 Back     alignment and structure
 Score =  106 bits (266), Expect = 1e-30
 Identities = 21/70 (30%), Positives = 35/70 (50%), Gaps = 1/70 (1%)

Query: 28  MKWKQ-ANVFKRHGLEPINPLGEKFDPNFHEALFEQEVEGKEANTVVVVSKIGYKLYNRV 86
           +  K   +V ++ G+E I       DPN H+A+   E +      V+ + + GY L  R 
Sbjct: 125 LTLKSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRT 184

Query: 87  IRPALVGISK 96
           IR A+V ++K
Sbjct: 185 IRAAMVTVAK 194


>4ani_A Protein GRPE; chaperone cycle, complementary assay; 4.09A {Geobacillus kaustophilus} Length = 213 Back     alignment and structure
>3a6m_A Protein GRPE, HSP-70 cofactor; coiled-coil, four-helix bundle, dimer, chaperone, STRE response; 3.23A {Thermus thermophilus} Length = 177 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query97
1dkg_A197 Nucleotide exchange factor GRPE; HSP70, GRPE, nucl 99.97
3a6m_A177 Protein GRPE, HSP-70 cofactor; coiled-coil, four-h 99.96
4ani_A213 Protein GRPE; chaperone cycle, complementary assay 99.96
>1dkg_A Nucleotide exchange factor GRPE; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: b.73.1.1 h.1.9.1 Back     alignment and structure
Probab=99.97  E-value=3.4e-31  Score=192.81  Aligned_cols=80  Identities=25%  Similarity=0.360  Sum_probs=77.1

Q ss_pred             hhccHHHHHHHHHHHHHHHHhCCCeeeCCCCCCCCcccceeeeEeecCCCCCCeeEEEEecCeeeCCEEeeeceEEeecC
Q psy2068          18 LTIDYSFVCRMKWKQANVFKRHGLEPINPLGEKFDPNFHEALFEQEVEGKEANTVVVVSKIGYKLYNRVIRPALVGISKS   97 (97)
Q Consensus        18 ~~~~~~G~~~i~~~l~~~L~~~Gv~~i~~~G~~FDP~~HeAv~~~~~~~~~~gtV~~V~~~GY~~~~rvLRpA~V~V~k~   97 (97)
                      .+++.+|++||+++|.++|+++||++|+++|++|||++||||+++++++.++|||++|+|+||+++|||||||+|+|+++
T Consensus       116 ~~~l~~Gv~~~~~~l~~~L~~~Gv~~i~~~G~~FDP~~HeAv~~~~~~~~~~~tVv~v~qkGY~l~dRvLRpA~V~V~~~  195 (197)
T 1dkg_A          116 MSAMVEDIELTLKSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTVAKA  195 (197)
T ss_dssp             CHHHHHHHHHHHHHHHHHHTTTTEEEECCCSSBCCTTSEEEEEEEECSSSCTTBEEEEEECEEEETTEEEECEEEEEEEC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCEEeCCCCCCCCHHHhheeeeecCCCCCcCeEEEEeeCCeeeCCEEecceEEEecCC
Confidence            46789999999999999999999999999999999999999999999999999999999999999999999999999974



>3a6m_A Protein GRPE, HSP-70 cofactor; coiled-coil, four-helix bundle, dimer, chaperone, STRE response; 3.23A {Thermus thermophilus} Back     alignment and structure
>4ani_A Protein GRPE; chaperone cycle, complementary assay; 4.09A {Geobacillus kaustophilus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 97
d1dkga159 b.73.1.1 (A:139-197) Head domain of nucleotide exc 9e-25
>d1dkga1 b.73.1.1 (A:139-197) Head domain of nucleotide exchange factor GrpE {Escherichia coli [TaxId: 562]} Length = 59 Back     information, alignment and structure

class: All beta proteins
fold: Head domain of nucleotide exchange factor GrpE
superfamily: Head domain of nucleotide exchange factor GrpE
family: Head domain of nucleotide exchange factor GrpE
domain: Head domain of nucleotide exchange factor GrpE
species: Escherichia coli [TaxId: 562]
 Score = 86.2 bits (214), Expect = 9e-25
 Identities = 18/56 (32%), Positives = 28/56 (50%)

Query: 41 LEPINPLGEKFDPNFHEALFEQEVEGKEANTVVVVSKIGYKLYNRVIRPALVGISK 96
          +E I       DPN H+A+   E +      V+ + + GY L  R IR A+V ++K
Sbjct: 1  VEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTVAK 56


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query97
d1dkga159 Head domain of nucleotide exchange factor GrpE {Es 99.94
>d1dkga1 b.73.1.1 (A:139-197) Head domain of nucleotide exchange factor GrpE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All beta proteins
fold: Head domain of nucleotide exchange factor GrpE
superfamily: Head domain of nucleotide exchange factor GrpE
family: Head domain of nucleotide exchange factor GrpE
domain: Head domain of nucleotide exchange factor GrpE
species: Escherichia coli [TaxId: 562]
Probab=99.94  E-value=2.8e-27  Score=142.18  Aligned_cols=57  Identities=32%  Similarity=0.491  Sum_probs=54.9

Q ss_pred             CeeeCCCCCCCCcccceeeeEeecCCCCCCeeEEEEecCeeeCCEEeeeceEEeecC
Q psy2068          41 LEPINPLGEKFDPNFHEALFEQEVEGKEANTVVVVSKIGYKLYNRVIRPALVGISKS   97 (97)
Q Consensus        41 v~~i~~~G~~FDP~~HeAv~~~~~~~~~~gtV~~V~~~GY~~~~rvLRpA~V~V~k~   97 (97)
                      |+.|+++|++|||++|||++++++++.++|+|++|+|+||+++|||||||+|+|+|+
T Consensus         1 ve~i~~~g~~FDP~~HeAv~~~~~~~~~~~~I~~v~~~GY~~~~rvlRpA~V~V~k~   57 (59)
T d1dkga1           1 VEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTVAKA   57 (59)
T ss_dssp             EEEECCCSSBCCTTSEEEEEEEECSSSCTTBEEEEEECEEEETTEEEECEEEEEEEC
T ss_pred             CceeCCCCCCCCHHHceEeeEecCCCCCCCEEEEEEeCCcEECCEEeeccEEEEecC
Confidence            578999999999999999999999999999999999999999999999999999984