Diaphorina citri psyllid: psy2081

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380

MTGYLGVYAQRTKHLFDYDVVNPKIEIIDGRRYRVNPSWPSTYEDKSEADPYQRSEYDAGCPGGNQPYEEDDGGLSEDEDLDIYLGKDGQYKYQCHIPKSFYPFIIGVKGSTKRRIESETNTQLSIPRQGQTGDIIISSYSERGIASAKRRLDLLLVFARKKIPYTHLLSIPMNVPNIQENFAKFKATVLSDFSRCRGIEESLFQEPGRLHITMGMLMLADSVERDQAVEVLQKCGNNIILPILRSQRIKINLKGLEIMNDDPAEVDILYAKVVDDSGLVQKLCDDVVQYFISQHLISKAYQKYDTVKMHVTLMNSKYRMRQNPSSDTNSEKRSTFNAKDILESLGDFEFGETFVYCVHLSQRHTHDMDGYFKPSAVISL

cccccEEEEEccccccccccccccEEEEccCEEccccccccccccccccccccccccccccccccccccccccccccccccccECcccccEEEEEEcccccccEECcccccHHHHHHHHccEEEEcccccccccEEEEEccHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccEEEEEEEEcccHHHHHHHHHHHHHcccccEEccccccEEEEEEEEcECccccccEEEEEEEEEccccHHHHHHHHHHHHHHHHccccccccccccccEEEEEEEEHHHcccccccccccccccccccHHHHHHHHcccccccEEccEEEEEccccccccccEEEEEEECc

**GYLGVYAQRTKHLFDYDVVNPKIEIIDGRRYRVNPSWP****************************************LDIYLGKDGQYKYQCHIPKSFYPFIIGVKGSTKRRIESETNTQLSIP*****GDIIISSYSERGIASAKRRLDLLLVFARKKIPYTHLLSIPMNVPNIQENFAKFKATVLSDFSRCRGIEESLFQEPGRLHITMGMLMLADSVERDQAVEVLQKCGNNIILPILRSQRIKINLKGLEIMNDDPAEVDILYAKVVDDSGLVQKLCDDVVQYFISQHLISKAYQKYDTVKMHVTLMNS********************NAKDILESLGDFEFGETFVYCVHLSQRHTHDMDGYFKPSAVISL

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Activating signal cointegrator 1 complex subunit 1	Enhances NF-kappa-B, SRF and AP1 transactivation.	confident	Q9D8Z1

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005737 [CC]	cytoplasm	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0003723 [MF]	RNA binding	probable	GO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0005667 [CC]	transcription factor complex	probable	GO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0006355 [BP]	regulation of transcription, DNA-dependent	probable	GO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2VFK, chain A
Confidence level:confident
Coverage over the Query: 164-380
View the alignment between query and template
View the model in PyMOL

Template: 2CTE, chain A
Confidence level:confident
Coverage over the Query: 82-163
View the alignment between query and template
View the model in PyMOL