Diaphorina citri psyllid: psy208

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440---

MMSQRVNTVSNSIFCFSSEFYCKALTLHLHLEGGMVSGQLRIPSHISVLHVEQEVVGDDTPAIDSVLECDTKRQNLLNREKTITQAINNGTADANMSTELTQVFAELEAIEADKAPARASVILAGLGFTPEMQKRATKHFSGGWRKMAIIWLENYLQNWPTTLLVVSHDRHFLDSVPTDIFHLHSQRIDTYRGNYEAFDKIKTEKLKNQQREIEAQRMHREHVQKFIDTFRYNANRASSVQSKIKQLERLPELKPIEKEVEVVLKFPDTELLSPPILQLSEVNFEYVPGKPILTNVCLGATLESRICIVGDNGAGKTTLLKIIMGIISPTAGTRTVHRNLKFGYFSQHHVDQLDMNLRCVQLLEAAFPGKPQEEYRRQLGGFGVSGDLALQFVGSLSGGQKSRVAFARMCMAAPNFLVLDEPTNHLDIETIEALGKAINKYTF

ccccEEEECcccccccHHHHHHHHHHHHccccccccccccccccccEEEEEEcccccccccHHHHHHHccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHcccccHHHHHcccccccHHHHHHHHHHHHHHHcccccEEEEEEccccHHHHHcccEEEEccccccEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccccccccccEEEEEccccccccccEEEEEcEEEECcccccccccccccccccccEEEEccccccHHHHHHHHccccccccCEEECccccEEEEccccccccccccccHHHHHHHHcccccHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHHccc

**SQRVNTVSNSIFCFSSEFYCKALTLHLHLEGGMVSGQLRIPSHISVLHVEQEVVGDDTPAIDSVLECDTKRQNLLNREKTITQAINNGT****MSTELTQVFAELEAIEADKAPARASVILAGLGFTPEMQKRATKHFSGGWRKMAIIWLENYLQNWPTTLLVVSHDRHFLDSVPTDIFHLHSQRIDTYRGNYEAFDKIKTE****************EHVQKFIDTFRYNA****************PELKPIEKEVEVVLKFPDTELLSPPILQLSEVNFEYVPGKPILTNVCLGATLESRICIVGDNGAGKTTLLKIIMGIISPTAGTRTVHRNLKFGYFSQHHVDQLDMNLRCVQLLEAAFPGKPQEEYRRQLGGFGVSGDLALQFVGSLSGGQKSRVAFARMCMAAPNFLVLDEPTNHLDIETIEALGKAINKYTF

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
ATP-binding cassette sub-family F member 3		confident	Q5R9Z5
ATP-binding cassette sub-family F member 3		confident	Q66H39
ATP-binding cassette sub-family F member 3		confident	Q8K268

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005840 [CC]	ribosome	probable	GO:0005737, GO:0032991, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0005622, GO:0043226

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2IW3, chain A
Confidence level:very confident
Coverage over the Query: 116-206,225-226,248-441
View the alignment between query and template
View the model in PyMOL

Template: 3TIF, chain A
Confidence level:very confident
Coverage over the Query: 19-70,86-92,110-196
View the alignment between query and template
View the model in PyMOL