Diaphorina citri psyllid: psy2094


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-
RSDRYKRPSASYRKIPTVWKQVGYVTEINIYPLKSGYYLSVEKAFCDFKGLSRIGQGYPLSDRCFLLFNRSKGTYISNIAHNRLVLVKVTALDKDLIQFSVHNDDTYTPFVLNMADFNRSGSVHTIRMYEKDLVHAFDCGDAASEWFSRFLLGKEDPDIRLGYDCDEQRKLNGTIYERYRHHYGDHITNEDMGKYAYLASYMLMNEASVKDLNERLQLKGETEVSIHNFRGNIILSTDQAYEEDNWDWVRLNEDIILRGMKPCTRCTMTCLDPETGQKNLRTEPLKTLRSYRGPIGEKARALEKGSPRLGLYCGLYSRGTVQKGDPVYVAVSEKLNAKVYE
cccccccccccccccccccEEEEEEEEEEEEEccccccEEEcEEEEcccccccccccccccccEEEEEEccccCEEECcccccEEEEEEEEEcccEEEEECccccccccEECccccccccccCEEEEEEEcccccEEEccHHHHHHHHHHHcccccccEEEECccccccccccccccccccccccccccccccccccccEEEEccHHHHHHHHHHHHcccccccccccccccEEEccccccccccccEEEEcccEEEEEECcccccccccccccccccccccccHHHHHHHccccccccccccccccCEEEEEEEccccEEEEccCEEEEEEccccccccc
***********YRKIPTVWKQVGYVTEINIYPLKSGYYLSVEKAFCDFKGLSRIGQGYPLSDRCFLLFNRSKGTYISNIAHNRLVLVKVTALDKDLIQFSVHNDDTYTPFVLNMADFNRSGSVHTIRMYEKDLVHAFDCGDAASEWFSRFLLGKEDPDIRLGYDCDEQRKLNGTIYERYRHHYGDHITNEDMGKYAYLASYMLMNEASVKDLNERLQLKGETEVSIHNFRGNIILSTDQAYEEDNWDWVRLNEDIILRGMKPCTRCTMTCLDPETGQKNLRTEPLKTLRSYRGPIGEKARALEKGSPRLGLYCGLYSRGTVQKGDPVYVAVS*********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
RSDRYKRPSASYRKIPTVWKQVGYVTEINIYPLKSGYYLSVEKAFCDFKGLSRIGQGYPLSDRCFLLFNRSKGTYISNIAHNRLVLVKVTALDKDLIQFSVHNDDTYTPFVLNMADFNRSGSVHTIRMYEKDLVHAFDCGDAASEWFSRFLLGKEDPDIRLGYDCDEQRKLNGTIYERYRHHYGDHITNEDMGKYAYLASYMLMNEASVKDLNERLQLKGETEVSIHNFRGNIILSTDQAYEEDNWDWVRLNEDIILRGMKPCTRCTMTCLDPETGQKNLRTEPLKTLRSYRGPIGEKARALEKGSPRLGLYCGLYSRGTVQKGDPVYVAVSEKLNAKVYE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
MOSC domain-containing protein 1, mitochondrial As a component of an N-hydroxylated prodrug-converting complex required to reduce N-hydroxylated prodrugs, such as benzamidoxime. Also able to reduce N(omega)-hydroxy-L-arginine (NOHA) and N(omega)-hydroxy-N(delta)-methyl-L-arginine (NHAM) into L-arginine and N(delta)-methyl-L-arginine, respectively.confidentQ9CW42
MOSC domain-containing protein 1, mitochondrial As a component of an N-hydroxylated prodrug-converting complex required to reduce N-hydroxylated prodrugs, such as benzamidoxime. Also able to reduce N(omega)-hydroxy-L-arginine (NOHA) and N(omega)-hydroxy-N(delta)-methyl-L-arginine (NHAM) into L-arginine and N(delta)-methyl-L-arginine, respectively.confidentQ5VT66
MOSC domain-containing protein 1, mitochondrial As a component of an N-hydroxylated prodrug-converting complex required to reduce N-hydroxylated prodrugs, such as benzamidoxime. Also able to reduce N(omega)-hydroxy-L-arginine (NOHA) and N(omega)-hydroxy-N(delta)-methyl-L-arginine (NHAM) into L-arginine and N(delta)-methyl-L-arginine, respectively.confidentQ58EJ9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0055114 [BP]oxidation-reduction processprobableGO:0044710, GO:0008150, GO:0008152
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0008940 [MF]nitrate reductase activityprobableGO:0016661, GO:0003824, GO:0003674, GO:0016491
GO:0043546 [MF]molybdopterin cofactor bindingprobableGO:0050662, GO:0097159, GO:0003674, GO:0005488, GO:0048037, GO:1901363
GO:0030151 [MF]molybdenum ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0042126 [BP]nitrate metabolic processprobableGO:0044710, GO:0006082, GO:0009987, GO:0044237, GO:2001057, GO:0006807, GO:0008150, GO:0044281, GO:0008152, GO:0043436
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2EXN, chain A
Confidence level:confident
Coverage over the Query: 25-167
View the alignment between query and template
View the model in PyMOL
Template: 1ORU, chain A
Confidence level:confident
Coverage over the Query: 197-292,306-333
View the alignment between query and template
View the model in PyMOL