Diaphorina citri psyllid: psy2107


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-
MAEEENTVETSDVPSEVQLKFFTKQEKYAVPDLVFAVQGNLGVPGLNSLINEILKEDSNEDNYKDIQFDFLIAGELLRTSVTSFLESKGISSENVIDVEYLESTPTPSPLDCILHDDWVSAIDFHNDWILTGCYDHSVHIWTRRGEHKLNIPGHGGPVKGVAWLYNDGKDAAFISVSTDQTAMIWEWKVESNSIECIHVCRGHERGLETVTVSESRQQFATGGWDCLLKIWSADISKERGDPSENGDEGTTSKKRKKEYSSASSRTPLITLKGHKEAISAVQWTAVDEIITSSWDHTLKIWDAELGGMKSEIVGNKSFFDVHYSPLSKLVITASADKQIRLYDPKVKEGAIVKSTFSSHKEWVQSVRWSPIDPQLFVSASFDNSVKLWDLR
ccccccccccccccccEEEEEEcccccEECccCEEEEcccccccccHHHHHHHHcccccccccccCEEEEEEcccEEEEcHHHHHHccccccccCEEEEEccccccccccccccccccEEEEEEcccCEEEECcccEEEEEEccccEEEEECcccccEEEEEEEcccccccEEEEccccccEEEEEcccccccEEEEEEEEcccccEEEEEEcccccEEEEEEccccEEEEEccccccccccccccccEEEcccccEEEccccccccEEEcccccccEEEEEEcccccEEEEEccccEEEEEcccccEEEEEEccccEEEEEEcccccEEEEccccccEEEEcccccccCEEccccccccccEEEEEEccccccEEEEECccccEEEEEcc
***********DVPSEVQLKFFTKQEKYAVPDLVFAVQGNLGVPGLNSLINEILKEDSNEDNYKDIQFDFLIAGELLRTSVTSFLESKGISSENVIDVEYLESTPTPSPLDCILHDDWVSAIDFHNDWILTGCYDHSVHIWTRRGEHKLNIPGHGGPVKGVAWLYNDGKDAAFISVSTDQTAMIWEWKVESNSIECIHVCRGHERGLETVTVSESRQQFATGGWDCLLKIWSADISKE******************KEYSSASSRTPLITLKGHKEAISAVQWTAVDEIITSSWDHTLKIWDAELGGMKSEIVGNKSFFDVHYSPLSKLVITASADKQIRLYDPKVKEGAIVKSTFSSHKEWVQSVRWSPIDPQLFVSASFDNSVKLWDLR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEEENTVETSDVPSEVQLKFFTKQEKYAVPDLVFAVQGNLGVPGLNSLINEILKEDSNEDNYKDIQFDFLIAGELLRTSVTSFLESKGISSENVIDVEYLESTPTPSPLDCILHDDWVSAIDFHNDWILTGCYDHSVHIWTRRGEHKLNIPGHGGPVKGVAWLYNDGKDAAFISVSTDQTAMIWEWKVESNSIECIHVCRGHERGLETVTVSESRQQFATGGWDCLLKIWSADISKERGDPSENGDEGTTSKKRKKEYSSASSRTPLITLKGHKEAISAVQWTAVDEIITSSWDHTLKIWDAELGGMKSEIVGNKSFFDVHYSPLSKLVITASADKQIRLYDPKVKEGAIVKSTFSSHKEWVQSVRWSPIDPQLFVSASFDNSVKLWDLR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ribosome biogenesis protein WDR12 Component of the PeBoW complex, which is required for maturation of 28S and 5.8S ribosomal RNAs and formation of the 60S ribosome.confidentQ9JJA4
Ribosome biogenesis protein WDR12 Component of the PeBoW complex, which is required for maturation of 28S and 5.8S ribosomal RNAs and formation of the 60S ribosome.confidentQ9GZL7
Ribosome biogenesis protein WDR12 Component of the PeBoW complex, which is required for maturation of 28S and 5.8S ribosomal RNAs and formation of the 60S ribosome.confidentQ0VC24

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005634 [CC]nucleusconfidentGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0030687 [CC]preribosome, large subunit precursorprobableGO:0032991, GO:0044464, GO:0030684, GO:0005623, GO:0030529, GO:0005575, GO:0044424, GO:0005622
GO:0005654 [CC]nucleoplasmprobableGO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0009506 [CC]plasmodesmaprobableGO:0055044, GO:0005575, GO:0030054, GO:0005911
GO:0070545 [CC]PeBoW complexprobableGO:0030686, GO:0031974, GO:0030684, GO:0043229, GO:0043228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005730, GO:0005634, GO:0030529, GO:0044452, GO:0043234, GO:0032991, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0008283 [BP]cell proliferationprobableGO:0008150, GO:0044699
GO:0040010 [BP]positive regulation of growth rateprobableGO:0045927, GO:0040008, GO:0040009, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0040019 [BP]positive regulation of embryonic developmentprobableGO:0051239, GO:0051094, GO:0050793, GO:0008150, GO:2000026, GO:0045995, GO:0048518, GO:0065007, GO:0050789
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0002119 [BP]nematode larval developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0045502 [MF]dynein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0040035 [BP]hermaphrodite genitalia developmentprobableGO:0032502, GO:0007548, GO:0032501, GO:0048608, GO:0000003, GO:0044707, GO:0022414, GO:0061458, GO:0048856, GO:0044767, GO:0003006, GO:0048513, GO:0048806, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0007276 [BP]gamete generationprobableGO:0044702, GO:0000003, GO:0032504, GO:0019953, GO:0022414, GO:0032501, GO:0008150, GO:0044699, GO:0048609
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0071944 [CC]cell peripheryprobableGO:0005575, GO:0044464, GO:0005623
GO:0022008 [BP]neurogenesisprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699
GO:0000463 [BP]maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)probableGO:0090304, GO:0034641, GO:0006807, GO:0000470, GO:0034660, GO:0071840, GO:0042273, GO:0006139, GO:0044260, GO:1901360, GO:0042254, GO:0071704, GO:0010467, GO:0006364, GO:0022613, GO:0034470, GO:0009987, GO:0006725, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0044238, GO:0016072, GO:0044237, GO:0043170, GO:0044085, GO:0006396
GO:0000466 [BP]maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)probableGO:0090304, GO:0034641, GO:0006807, GO:0034660, GO:0071840, GO:0006139, GO:0044260, GO:1901360, GO:0042254, GO:0071704, GO:0010467, GO:0006364, GO:0022613, GO:0034470, GO:0009987, GO:0006725, GO:0000460, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0044238, GO:0016072, GO:0044237, GO:0043170, GO:0044085, GO:0006396
GO:0016043 [BP]cellular component organizationprobableGO:0008150, GO:0071840
GO:0007219 [BP]Notch signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0042995 [CC]cell projectionprobableGO:0005575, GO:0044464, GO:0005623
GO:0040007 [BP]growthprobableGO:0008150

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1VYH, chain C
Confidence level:very confident
Coverage over the Query: 67-79,90-235,265-389
View the alignment between query and template
View the model in PyMOL
Template: 3SFZ, chain A
Confidence level:very confident
Coverage over the Query: 66-79,90-391
View the alignment between query and template
View the model in PyMOL