Psyllid ID: psy2107


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-
MAEEENTVETSDVPSEVQLKFFTKQEKYAVPDLVFAVQGNLGVPGLNSLINEILKEDSNEDNYKDIQFDFLIAGELLRTSVTSFLESKGISSENVIDVEYLESTPTPSPLDCILHDDWVSAIDFHNDWILTGCYDHSVHIWTRRGEHKLNIPGHGGPVKGVAWLYNDGKDAAFISVSTDQTAMIWEWKVESNSIECIHVCRGHERGLETVTVSESRQQFATGGWDCLLKIWSADISKERGDPSENGDEGTTSKKRKKEYSSASSRTPLITLKGHKEAISAVQWTAVDEIITSSWDHTLKIWDAELGGMKSEIVGNKSFFDVHYSPLSKLVITASADKQIRLYDPKVKEGAIVKSTFSSHKEWVQSVRWSPIDPQLFVSASFDNSVKLWDLR
ccccccccccccccccEEEEEEcccccEEEccEEEEEcccccccccHHHHHHHHcccccccccccEEEEEEEcccEEEEcHHHHHHHcccccccEEEEEEccccccccccccccccccEEEEEEcccEEEEEEcccEEEEEEccccEEEEEEcccccEEEEEEEcccccccEEEEccccccEEEEEcccccccEEEEEEEEcccccEEEEEEcccccEEEEEEccccEEEEEccccccccccccccccEEEcccccEEEccccccccEEEcccccccEEEEEEcccccEEEEEccccEEEEEcccccEEEEEEccccEEEEEEcccccEEEEccccccEEEEcccccccEEEccccccccccEEEEEEccccccEEEEEEccccEEEEEcc
cccEcccccccccccEEEEEEEEccccEEcccccEEEcccccHHHHHHHHHHHHHHHHccccccccEEEEEcccccEEEEEEEcccccEEEEcccccEEEEEccccccEEEEEcccccEEEEEEcccccEEcccccEEEEEEccccEEEEEccccccEEEEEEccccccccEEEEEccccEEEEEEcccccccccEEEEEEcccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEcccccEEEEEcccccEEEEEcccccEEEEEEcccccEEEEEEccccEEEEEccccEEEEEEcccccEEEEEEccccEEEEEEcccccEEEEEccccEEEEEEcccccccEEEEEEccccccEEEEEEccccccEEEEEccccEEEEEEcc
maeeentvetsdvpsevQLKFFtkqekyavpdlvfavqgnlgvpglnSLINEILKedsnednykdiqFDFLIAGELLRTSVTSFLeskgissenvidveylestptpspldcilhddwvsaidfhndwiltgcydhsvhiwtrrgehklnipghggpvkGVAWLYndgkdaafisvSTDQTAMIWEWKVESNSIECIHVCrghergletvTVSESRQQFATGGWDCLLKIWSAdiskergdpsengdegttskkrkkeyssassrtplitlkghKEAISAVQWTAVDEIITSSWDHTLKIWDAelggmkseivgnksffdvhysplSKLVITASadkqirlydpkvkegaiVKSTFSSHKEWVqsvrwspidpqlfvsasfdnsvklwdlr
maeeentvetsdvpsevQLKFFTKQEKYAVPDLVFAVQGNLGVPGLNSLINEILKEDSNEDNYKDIQFDFLIAGELLRTSVTSFleskgissenvIDVEYLESTPTPSPLDCILHDDWVSAIDFHNDWILTGCYDHSVHIWTRRGEHKLNIPGHGGPVKGVAWLYNDGKDAAFISVSTDQTAMIWEWKVESNSIECIHVCRGHERGLETVTVSESRQQFATGGWDCLLKIWSADiskergdpsengdegttskkrkkeyssassrtplitlkghkEAISAVQWTAVDEIITSSWDHTLKIWDAELGGMKSEIVGNKSFFDVHYSPLSKLVITASADKQIRLYDPKVKEGAIVKSTFSSHKEWVQSVRwspidpqlfvsasfdnsvklwdlr
MAEEENTVETSDVPSEVQLKFFTKQEKYAVPDLVFAVQGNLGVPGLNSLINEILKEDSNEDNYKDIQFDFLIAGELLRTSVTSFLESKGISSENVIDVEYLESTPTPSPLDCILHDDWVSAIDFHNDWILTGCYDHSVHIWTRRGEHKLNIPGHGGPVKGVAWLYNDGKDAAFISVSTDQTAMIWEWKVESNSIECIHVCRGHERGLETVTVSESRQQFATGGWDCLLKIWSADISKERGDPSENGDEGTTSKKRKKEYSSASSRTPLITLKGHKEAISAVQWTAVDEIITSSWDHTLKIWDAELGGMKSEIVGNKSFFDVHYSPLSKLVITASADKQIRLYDPKVKEGAIVKSTFSSHKEWVQSVRWSPIDPQLFVSASFDNSVKLWDLR
*****************QLKFFTKQEKYAVPDLVFAVQGNLGVPGLNSLINEILKEDSNEDNYKDIQFDFLIAGELLRTSVTSFLESKGISSENVIDVEYLESTPTPSPLDCILHDDWVSAIDFHNDWILTGCYDHSVHIWTRRGEHKLNIPGHGGPVKGVAWLYNDGKDAAFISVSTDQTAMIWEWKVESNSIECIHVCRGHERGLETVTVSESRQQFATGGWDCLLKIWSAD*********************************LITLKGHKEAISAVQWTAVDEIITSSWDHTLKIWDAELGGMKSEIVGNKSFFDVHYSPLSKLVITASADKQIRLYDPKVKEGAIVKSTFSSHKEWVQSVRWSPIDPQLFVSASFDNSVKLW***
*****NT****DVPSEVQLKFFTKQEKYAVPDLVFAVQGNLGVPGLNSLINEILKEDSNEDNYKDIQFDFLIAGELLRTSVTSFLESKGISSENVIDVEYLESTPTPSPLDCILHDDWVSAIDFHNDWILTGCYDHSVHIWTRRGEHKLNIPGHGGPVKGVAWLYNDGKDAAFISVSTDQTAMIWEWKVESNSIECIHVCRGHERGLETVTVSESRQQFATGGWDCLLKIWSADISKE******************KEYSSASSRTPLITLKGHKEAISAVQWTAVDEIITSSWDHTLKIWDAELGGMKSEIVGNKSFFDVHYSPLSKLVITASADKQIRLYDPKVKEGAIVKSTFSSHKEWVQSVRWSPIDPQLFVSASFDNSVKLWDLR
*************PSEVQLKFFTKQEKYAVPDLVFAVQGNLGVPGLNSLINEILKEDSNEDNYKDIQFDFLIAGELLRTSVTSFLESKGISSENVIDVEYLESTPTPSPLDCILHDDWVSAIDFHNDWILTGCYDHSVHIWTRRGEHKLNIPGHGGPVKGVAWLYNDGKDAAFISVSTDQTAMIWEWKVESNSIECIHVCRGHERGLETVTVSESRQQFATGGWDCLLKIWSADISK***************************RTPLITLKGHKEAISAVQWTAVDEIITSSWDHTLKIWDAELGGMKSEIVGNKSFFDVHYSPLSKLVITASADKQIRLYDPKVKEGAIVKSTFSSHKEWVQSVRWSPIDPQLFVSASFDNSVKLWDLR
********ETSDVPSEVQLKFFTKQEKYAVPDLVFAVQGNLGVPGLNSLINEILKEDSNEDNYKDIQFDFLIAGELLRTSVTSFLESKGISSENVIDVEYLESTPTPSPLDCILHDDWVSAIDFHNDWILTGCYDHSVHIWTRRGEHKLNIPGHGGPVKGVAWLYNDGKDAAFISVSTDQTAMIWEWKVESNSIECIHVCRGHERGLETVTVSESRQQFATGGWDCLLKIWSADISKERGDPSENGDEGTTSKKRKKEYSSASSRTPLITLKGHKEAISAVQWTAVDEIITSSWDHTLKIWDAELGGMKSEIVGNKSFFDVHYSPLSKLVITASADKQIRLYDPKVKEGAIVKSTFSSHKEWVQSVRWSPIDPQLFVSASFDNSVKLWDLR
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEEENTVETSDVPSEVQLKFFTKQEKYAVPDLVFAVQGNLGVPGLNSLINEILKEDSNEDNYKDIQFDFLIAGELLRTSVTSFLESKGISSENVIDVEYLESTPTPSPLDCILHDDWVSAIDFHNDWILTGCYDHSVHIWTRRGEHKLNIPGHGGPVKGVAWLYNDGKDAAFISVSTDQTAMIWEWKVESNSIECIHVCRGHERGLETVTVSESRQQFATGGWDCLLKIWSADISKERGDPSENGDEGTTSKKRKKEYSSASSRTPLITLKGHKEAISAVQWTAVDEIITSSWDHTLKIWDAELGGMKSEIVGNKSFFDVHYSPLSKLVITASADKQIRLYDPKVKEGAIVKSTFSSHKEWVQSVRWSPIDPQLFVSASFDNSVKLWDLR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query391 2.2.26 [Sep-21-2011]
Q17BB0427 Ribosome biogenesis prote N/A N/A 0.938 0.859 0.502 1e-114
B0W517425 Ribosome biogenesis prote N/A N/A 0.948 0.872 0.5 1e-114
Q7QJ33428 Ribosome biogenesis prote yes N/A 0.951 0.869 0.479 1e-112
B4KKN1419 Ribosome biogenesis prote N/A N/A 0.938 0.875 0.479 1e-109
B4LS78419 Ribosome biogenesis prote N/A N/A 0.938 0.875 0.484 1e-109
B4MU54423 Ribosome biogenesis prote N/A N/A 0.928 0.858 0.484 1e-108
B4P116420 Ribosome biogenesis prote N/A N/A 0.920 0.857 0.486 1e-107
B4JPT9419 Ribosome biogenesis prote N/A N/A 0.938 0.875 0.476 1e-107
B3N534420 Ribosome biogenesis prote N/A N/A 0.920 0.857 0.486 1e-107
Q9VKQ3420 Ribosome biogenesis prote yes N/A 0.920 0.857 0.484 1e-107
>sp|Q17BB0|WDR12_AEDAE Ribosome biogenesis protein WDR12 homolog OS=Aedes aegypti GN=AAEL005041 PE=3 SV=1 Back     alignment and function desciption
 Score =  412 bits (1059), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 189/376 (50%), Positives = 269/376 (71%), Gaps = 9/376 (2%)

Query: 16  EVQLKFFTKQEKYAVPDLVFAVQGNLGVPGLNSLINEILKEDSNEDNYKDIQFDFLIAGE 75
           ++QL  +TKQ+++AVPD+ ++++ N+    LN LIN +LK+  N +  K ++FDFL+ GE
Sbjct: 12  QLQLHLYTKQKQFAVPDVPYSIRANVSNKELNVLINTLLKDSGNSEAGK-VEFDFLLNGE 70

Query: 76  LLRTSVTSFLESKGISSENVIDVEYLESTPTPSPLDCILHDDWVSAIDFHNDWILTGCYD 135
            ++  +   L+ + IS E+ +++EY+E  P P P DC+LHDDWVSA++  ++WILTGCYD
Sbjct: 71  FVKIPLGQHLKEREISFEDTVELEYVERYPAPEPQDCLLHDDWVSAVEAKDNWILTGCYD 130

Query: 136 HSVHIWTRRGEHKLNIPGHGGPVKGVAWLYNDGKDAAFISVSTDQTAMIWEWKVESNSIE 195
           ++++IWT +G+HKL IPGH  PVKGV W+  D +   F S S DQT M+WEW V++NS+E
Sbjct: 131 NTLNIWTTKGKHKLTIPGHIAPVKGVTWISLDEEKGVFASASQDQTVMLWEWNVKANSVE 190

Query: 196 CIHVCRGHERGLETVTVSESRQQFATGGWDCLLKIWSADISKERGDPSENGDEGTTSKKR 255
           C+ VC+GHERG++ +  + S+ + ATG WD +LKIWS D+   R D    GD   ++ KR
Sbjct: 191 CVQVCKGHERGVDCIAANRSKTRMATGSWDTMLKIWSTDV---RND----GDSQPSTSKR 243

Query: 256 KKEYSSASSRTPLITLKGHKEAISAVQWTAVDEIITSSWDHTLKIWDAELGGMKSEIVGN 315
           +K   +  +RTP++TL GH+E IS VQW   + ++TSSWDHT+KIWD  L G+KSEI G+
Sbjct: 244 QK-LDTEKARTPVLTLAGHRECISGVQWIDDNTLVTSSWDHTIKIWDLALSGIKSEICGH 302

Query: 316 KSFFDVHYSPLSKLVITASADKQIRLYDPKVKEGAIVKSTFSSHKEWVQSVRWSPIDPQL 375
           KSFFD+ YS L+ L+I AS DK +RLYDPK  +G IVK+T+  H +WVQSVRWS  +  L
Sbjct: 303 KSFFDLSYSHLNGLIIAASPDKNLRLYDPKSNQGTIVKNTYLGHTQWVQSVRWSTTNEYL 362

Query: 376 FVSASFDNSVKLWDLR 391
           FVS ++DN VKLWD R
Sbjct: 363 FVSGAYDNHVKLWDYR 378




Required for maturation of ribosomal RNAs and formation of the large ribosomal subunit.
Aedes aegypti (taxid: 7159)
>sp|B0W517|WDR12_CULQU Ribosome biogenesis protein WDR12 homolog OS=Culex quinquefasciatus GN=CPIJ001500 PE=3 SV=2 Back     alignment and function description
>sp|Q7QJ33|WDR12_ANOGA Ribosome biogenesis protein WDR12 homolog OS=Anopheles gambiae GN=AGAP007244 PE=3 SV=3 Back     alignment and function description
>sp|B4KKN1|WDR12_DROMO Ribosome biogenesis protein WDR12 homolog OS=Drosophila mojavensis GN=GI17814 PE=3 SV=1 Back     alignment and function description
>sp|B4LS78|WDR12_DROVI Ribosome biogenesis protein WDR12 homolog OS=Drosophila virilis GN=GJ17641 PE=3 SV=1 Back     alignment and function description
>sp|B4MU54|WDR12_DROWI Ribosome biogenesis protein WDR12 homolog OS=Drosophila willistoni GN=GK23981 PE=3 SV=1 Back     alignment and function description
>sp|B4P116|WDR12_DROYA Ribosome biogenesis protein WDR12 homolog OS=Drosophila yakuba GN=GE13328 PE=2 SV=1 Back     alignment and function description
>sp|B4JPT9|WDR12_DROGR Ribosome biogenesis protein WDR12 homolog OS=Drosophila grimshawi GN=GH13339 PE=3 SV=1 Back     alignment and function description
>sp|B3N534|WDR12_DROER Ribosome biogenesis protein WDR12 homolog OS=Drosophila erecta GN=GG10358 PE=3 SV=1 Back     alignment and function description
>sp|Q9VKQ3|WDR12_DROME Ribosome biogenesis protein WDR12 homolog OS=Drosophila melanogaster GN=CG6724 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query391
340712088423 PREDICTED: ribosome biogenesis protein W 0.936 0.865 0.561 1e-124
345493565422 PREDICTED: ribosome biogenesis protein W 0.959 0.888 0.534 1e-123
383861212423 PREDICTED: ribosome biogenesis protein W 0.959 0.886 0.533 1e-121
380030452423 PREDICTED: ribosome biogenesis protein W 0.961 0.888 0.542 1e-121
328783893423 PREDICTED: ribosome biogenesis protein W 0.936 0.865 0.545 1e-120
157108390427 wd-repeat protein [Aedes aegypti] gi|122 0.938 0.859 0.502 1e-112
226698191425 RecName: Full=Ribosome biogenesis protei 0.948 0.872 0.5 1e-112
332025573443 Ribosome biogenesis protein WDR12-like p 0.941 0.830 0.482 1e-110
118778288428 AGAP007244-PA [Anopheles gambiae str. PE 0.951 0.869 0.479 1e-110
322800369433 hypothetical protein SINV_04859 [Solenop 0.969 0.875 0.470 1e-110
>gi|340712088|ref|XP_003394596.1| PREDICTED: ribosome biogenesis protein WDR12 homolog [Bombus terrestris] Back     alignment and taxonomy information
 Score =  452 bits (1164), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 211/376 (56%), Positives = 276/376 (73%), Gaps = 10/376 (2%)

Query: 16  EVQLKFFTKQEKYAVPDLVFAVQGNLGVPGLNSLINEILKEDSNEDNYKDIQFDFLIAGE 75
           +VQ+KF TKQE+YAVPD   +V  ++    LN+L+NE+LKE +N  N  DI+FDFL+  +
Sbjct: 12  QVQIKFLTKQEQYAVPDFPLSVHTSIVTSELNTLVNELLKESTNIKN--DIEFDFLVCSQ 69

Query: 76  LLRTSVTSFLESKGISSENVIDVEYLESTPTPSPLDCILHDDWVSAIDFHNDWILTGCYD 135
            LRTS++  +  K IS+E VI VEY+E  P P P DC+LHDDWVSA+D +  WILTGCYD
Sbjct: 70  FLRTSLSEHIAEKNISTEEVIIVEYVEKYPPPEPQDCLLHDDWVSAVDVYEKWILTGCYD 129

Query: 136 HSVHIWTRRGEHKLNIPGHGGPVKGVAWLYNDGKDAAFISVSTDQTAMIWEWKVESNSIE 195
           +++HIWT +G+H L IPGH  PVK VAW+      A+F+S S DQTA+IW+W +  NS++
Sbjct: 130 NTLHIWTSKGKHHLVIPGHTSPVKAVAWISLTSDTASFVSASQDQTAIIWDWNIMENSVD 189

Query: 196 CIHVCRGHERGLETVTVSESRQQFATGGWDCLLKIWSADISKERGDPSENGDEGTTSKKR 255
           CIHVCRGHERGLE V+++  +   ATG WD +LKIWS        +  EN D  ++SK+ 
Sbjct: 190 CIHVCRGHERGLEAVSINYDKTIMATGSWDTMLKIWST------ANQDENEDGESSSKRL 243

Query: 256 KKEYSSASSRTPLITLKGHKEAISAVQWTAVDEIITSSWDHTLKIWDAELGGMKSEIVGN 315
           K E+    +R P  T+KGHKEAIS V W+   EIITSSWDHT+KIWD+ELGG+K E+ GN
Sbjct: 244 KSEH--GKTRVPKRTMKGHKEAISGVVWSDKTEIITSSWDHTIKIWDSELGGIKHELAGN 301

Query: 316 KSFFDVHYSPLSKLVITASADKQIRLYDPKVKEGAIVKSTFSSHKEWVQSVRWSPIDPQL 375
           KSFFD+ YSPL++ VITASAD+ IRLYDP+  EG +VK+ F+SH +WVQSVRWSP+D  L
Sbjct: 302 KSFFDLDYSPLTRTVITASADRHIRLYDPRSTEGTLVKAIFTSHTQWVQSVRWSPVDETL 361

Query: 376 FVSASFDNSVKLWDLR 391
           F+S ++DN +KLWD R
Sbjct: 362 FISGAYDNEMKLWDTR 377




Source: Bombus terrestris

Species: Bombus terrestris

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|345493565|ref|XP_001602606.2| PREDICTED: ribosome biogenesis protein WDR12 homolog [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|383861212|ref|XP_003706080.1| PREDICTED: ribosome biogenesis protein WDR12 homolog [Megachile rotundata] Back     alignment and taxonomy information
>gi|380030452|ref|XP_003698862.1| PREDICTED: ribosome biogenesis protein WDR12 homolog [Apis florea] Back     alignment and taxonomy information
>gi|328783893|ref|XP_396848.3| PREDICTED: ribosome biogenesis protein WDR12 homolog [Apis mellifera] Back     alignment and taxonomy information
>gi|157108390|ref|XP_001650205.1| wd-repeat protein [Aedes aegypti] gi|122106389|sp|Q17BB0.1|WDR12_AEDAE RecName: Full=Ribosome biogenesis protein WDR12 homolog gi|108879311|gb|EAT43536.1| AAEL005041-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|226698191|sp|B0W517.2|WDR12_CULQU RecName: Full=Ribosome biogenesis protein WDR12 homolog Back     alignment and taxonomy information
>gi|332025573|gb|EGI65736.1| Ribosome biogenesis protein WDR12-like protein [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|118778288|ref|XP_308556.3| AGAP007244-PA [Anopheles gambiae str. PEST] gi|226698195|sp|Q7QJ33.3|WDR12_ANOGA RecName: Full=Ribosome biogenesis protein WDR12 homolog gi|116132311|gb|EAA04191.3| AGAP007244-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|322800369|gb|EFZ21373.1| hypothetical protein SINV_04859 [Solenopsis invicta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query391
UNIPROTKB|Q17BB0427 AAEL005041 "Ribosome biogenesi 0.953 0.873 0.497 7e-109
UNIPROTKB|B0W517425 CPIJ001500 "Ribosome biogenesi 0.948 0.872 0.5 9e-109
UNIPROTKB|Q7QJ33428 AGAP007244 "Ribosome biogenesi 0.951 0.869 0.479 2.8e-105
UNIPROTKB|B4LS78419 GJ17641 "Ribosome biogenesis p 0.938 0.875 0.489 2.9e-103
UNIPROTKB|B4MU54423 GK23981 "Ribosome biogenesis p 0.928 0.858 0.484 7.7e-103
UNIPROTKB|B4KKN1419 GI17814 "Ribosome biogenesis p 0.938 0.875 0.479 1.3e-102
UNIPROTKB|B4P116420 GE13328 "Ribosome biogenesis p 0.936 0.871 0.484 2.6e-102
UNIPROTKB|B3N534420 GG10358 "Ribosome biogenesis p 0.936 0.871 0.484 4.2e-102
UNIPROTKB|B4JPT9419 GH13339 "Ribosome biogenesis p 0.938 0.875 0.479 5.4e-102
FB|FBgn0032298420 CG6724 [Drosophila melanogaste 0.920 0.857 0.484 8.8e-102
UNIPROTKB|Q17BB0 AAEL005041 "Ribosome biogenesis protein WDR12 homolog" [Aedes aegypti (taxid:7159)] Back     alignment and assigned GO terms
 Score = 1076 (383.8 bits), Expect = 7.0e-109, P = 7.0e-109
 Identities = 190/382 (49%), Positives = 271/382 (70%)

Query:    10 TSDVPSEVQLKFFTKQEKYAVPDLVFAVQGNLGVPGLNSLINEILKEDSNEDNYKDIQFD 69
             T     ++QL  +TKQ+++AVPD+ ++++ N+    LN LIN +LK+  N +  K ++FD
Sbjct:     6 TGKSEGQLQLHLYTKQKQFAVPDVPYSIRANVSNKELNVLINTLLKDSGNSEAGK-VEFD 64

Query:    70 FLIAGELLRTSVTSFLESKGISSENVIDVEYLESTPTPSPLDCILHDDWVSAIDFHNDWI 129
             FL+ GE ++  +   L+ + IS E+ +++EY+E  P P P DC+LHDDWVSA++  ++WI
Sbjct:    65 FLLNGEFVKIPLGQHLKEREISFEDTVELEYVERYPAPEPQDCLLHDDWVSAVEAKDNWI 124

Query:   130 LTGCYDHSVHIWTRRGEHKLNIPGHGGPVKGVAWLYNDGKDAAFISVSTDQTAMIWEWKV 189
             LTGCYD++++IWT +G+HKL IPGH  PVKGV W+  D +   F S S DQT M+WEW V
Sbjct:   125 LTGCYDNTLNIWTTKGKHKLTIPGHIAPVKGVTWISLDEEKGVFASASQDQTVMLWEWNV 184

Query:   190 ESNSIECIHVCRGHERGLETVTVSESRQQFATGGWDCLLKIWSADISKERGDPSENGDEG 249
             ++NS+EC+ VC+GHERG++ +  + S+ + ATG WD +LKIWS D+  + GD      + 
Sbjct:   185 KANSVECVQVCKGHERGVDCIAANRSKTRMATGSWDTMLKIWSTDVRND-GD-----SQP 238

Query:   250 TTSKKRKKEYSSASSRTPLITLKGHKEAISAVQWTAVDEIITSSWDHTLKIWDAELGGMK 309
             +TSK++K +   A  RTP++TL GH+E IS VQW   + ++TSSWDHT+KIWD  L G+K
Sbjct:   239 STSKRQKLDTEKA--RTPVLTLAGHRECISGVQWIDDNTLVTSSWDHTIKIWDLALSGIK 296

Query:   310 SEIVGNKSFFDVHYSPLSKLVITASADKQIRLYDPKVKEGAIVKSTFSSHKEWVQSVRWS 369
             SEI G+KSFFD+ YS L+ L+I AS DK +RLYDPK  +G IVK+T+  H +WVQSVRWS
Sbjct:   297 SEICGHKSFFDLSYSHLNGLIIAASPDKNLRLYDPKSNQGTIVKNTYLGHTQWVQSVRWS 356

Query:   370 PIDPQLFVSASFDNSVKLWDLR 391
               +  LFVS ++DN VKLWD R
Sbjct:   357 TTNEYLFVSGAYDNHVKLWDYR 378




GO:0000463 "maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)" evidence=ISS
GO:0070545 "PeBoW complex" evidence=ISS
UNIPROTKB|B0W517 CPIJ001500 "Ribosome biogenesis protein WDR12 homolog" [Culex quinquefasciatus (taxid:7176)] Back     alignment and assigned GO terms
UNIPROTKB|Q7QJ33 AGAP007244 "Ribosome biogenesis protein WDR12 homolog" [Anopheles gambiae (taxid:7165)] Back     alignment and assigned GO terms
UNIPROTKB|B4LS78 GJ17641 "Ribosome biogenesis protein WDR12 homolog" [Drosophila virilis (taxid:7244)] Back     alignment and assigned GO terms
UNIPROTKB|B4MU54 GK23981 "Ribosome biogenesis protein WDR12 homolog" [Drosophila willistoni (taxid:7260)] Back     alignment and assigned GO terms
UNIPROTKB|B4KKN1 GI17814 "Ribosome biogenesis protein WDR12 homolog" [Drosophila mojavensis (taxid:7230)] Back     alignment and assigned GO terms
UNIPROTKB|B4P116 GE13328 "Ribosome biogenesis protein WDR12 homolog" [Drosophila yakuba (taxid:7245)] Back     alignment and assigned GO terms
UNIPROTKB|B3N534 GG10358 "Ribosome biogenesis protein WDR12 homolog" [Drosophila erecta (taxid:7220)] Back     alignment and assigned GO terms
UNIPROTKB|B4JPT9 GH13339 "Ribosome biogenesis protein WDR12 homolog" [Drosophila grimshawi (taxid:7222)] Back     alignment and assigned GO terms
FB|FBgn0032298 CG6724 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P91343WDR12_CAEELNo assigned EC number0.32110.94620.8428yesN/A
Q6BLS5YTM1_DEBHANo assigned EC number0.27810.96410.8090yesN/A
Q6NX08WDR12_DANRENo assigned EC number0.41370.94880.8791yesN/A
Q5REE6WDR12_PONABNo assigned EC number0.42210.94620.8747yesN/A
Q5BJ90WDR12_XENTRNo assigned EC number0.42440.95140.8794yesN/A
P61480WDR12_RATNo assigned EC number0.41900.95140.8794yesN/A
Q9GZL7WDR12_HUMANNo assigned EC number0.42480.94620.8747yesN/A
Q0VC24WDR12_BOVINNo assigned EC number0.42740.94620.8747yesN/A
Q29KQ0WDR12_DROPSNo assigned EC number0.48930.91810.8568yesN/A
Q9VKQ3WDR12_DROMENo assigned EC number0.48400.92070.8571yesN/A
Q6CU59YTM1_KLULANo assigned EC number0.29890.93090.8198yesN/A
A3LQ86YTM1_PICSTNo assigned EC number0.28460.96410.8072yesN/A
Q7QJ33WDR12_ANOGANo assigned EC number0.47900.95140.8691yesN/A
Q9JJA4WDR12_MOUSENo assigned EC number0.41680.94620.8747yesN/A
Q17BB0WDR12_AEDAENo assigned EC number0.50260.93860.8594N/AN/A
Q756D0YTM1_ASHGONo assigned EC number0.29380.91560.8044yesN/A
Q9URY0YTM1_SCHPONo assigned EC number0.30120.93350.8295yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query391
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 3e-40
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 5e-34
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 2e-32
cd00200 289 cd00200, WD40, WD40 domain, found in a number of e 1e-21
COG2319 466 COG2319, COG2319, FOG: WD40 repeat [General functi 2e-21
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 2e-19
pfam0815464 pfam08154, NLE, NLE (NUC135) domain 1e-15
COG2319 466 COG2319, COG2319, FOG: WD40 repeat [General functi 4e-08
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 1e-06
smart0032040 smart00320, WD40, WD40 repeats 2e-06
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 2e-06
PTZ00420 568 PTZ00420, PTZ00420, coronin; Provisional 2e-05
smart0032040 smart00320, WD40, WD40 repeats 7e-05
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 1e-04
smart0032040 smart00320, WD40, WD40 repeats 2e-04
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 2e-04
PLN00181 793 PLN00181, PLN00181, protein SPA1-RELATED; Provisio 2e-04
PTZ00420 568 PTZ00420, PTZ00420, coronin; Provisional 4e-04
cd00200 289 cd00200, WD40, WD40 domain, found in a number of e 0.001
smart0032040 smart00320, WD40, WD40 repeats 0.001
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 0.001
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
 Score =  144 bits (364), Expect = 3e-40
 Identities = 71/282 (25%), Positives = 124/282 (43%), Gaps = 45/282 (15%)

Query: 115 HDDWVSAIDFHND--WILTGCYDHSVHIW-TRRGEHKLNIPGHGGPVKGVAWLYNDGKDA 171
           H   V+ + F  D   + TG  D ++ +W    GE    + GH GPV+ VA   +     
Sbjct: 8   HTGGVTCVAFSPDGKLLATGSGDGTIKVWDLETGELLRTLKGHTGPVRDVAASADGTY-- 65

Query: 172 AFISVSTDQTAMIWEWKVESNSIECIHVCRGHERGLETVTVSESRQQFATGGWDCLLKIW 231
              S S+D+T  +W+      + EC+    GH   + +V  S   +  ++   D  +K+W
Sbjct: 66  -LASGSSDKTIRLWDL----ETGECVRTLTGHTSYVSSVAFSPDGRILSSSSRDKTIKVW 120

Query: 232 SADISKERGDPSENGDEGTTSKKRKKEYSSASSRTPLITLKGHKEAISAVQWTAVDEIIT 291
             +                             +   L TL+GH + +++V ++     + 
Sbjct: 121 DVE-----------------------------TGKCLTTLRGHTDWVNSVAFSPDGTFVA 151

Query: 292 -SSWDHTLKIWDAELGGMKSEIVGNKSF-FDVHYSPLSKLVITASADKQIRLYDPKVKEG 349
            SS D T+K+WD   G   + + G+      V +SP  + ++++S+D  I+L+D     G
Sbjct: 152 SSSQDGTIKLWDLRTGKCVATLTGHTGEVNSVAFSPDGEKLLSSSSDGTIKLWDLS--TG 209

Query: 350 AIVKSTFSSHKEWVQSVRWSPIDPQLFVSASFDNSVKLWDLR 391
             +  T   H+  V SV +SP D  L  S S D ++++WDLR
Sbjct: 210 KCLG-TLRGHENGVNSVAFSP-DGYLLASGSEDGTIRVWDLR 249


Length = 289

>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|219730 pfam08154, NLE, NLE (NUC135) domain Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|240412 PTZ00420, PTZ00420, coronin; Provisional Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|177776 PLN00181, PLN00181, protein SPA1-RELATED; Provisional Back     alignment and domain information
>gnl|CDD|240412 PTZ00420, PTZ00420, coronin; Provisional Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 391
KOG0313|consensus423 100.0
KOG0271|consensus480 100.0
KOG0271|consensus480 100.0
KOG0272|consensus459 100.0
KOG0272|consensus459 100.0
KOG0286|consensus343 100.0
KOG0263|consensus707 100.0
KOG0279|consensus315 100.0
KOG0279|consensus315 100.0
KOG0273|consensus524 100.0
KOG0285|consensus460 100.0
KOG0295|consensus406 100.0
KOG0645|consensus312 100.0
KOG0281|consensus499 100.0
KOG0295|consensus406 100.0
KOG0281|consensus499 100.0
KOG0284|consensus464 100.0
KOG0316|consensus307 100.0
KOG0273|consensus524 100.0
KOG0282|consensus503 100.0
KOG0284|consensus 464 100.0
KOG0263|consensus707 100.0
KOG0265|consensus338 100.0
KOG0266|consensus456 100.0
KOG0277|consensus311 100.0
KOG0315|consensus311 100.0
KOG0286|consensus343 100.0
KOG0296|consensus399 100.0
KOG0291|consensus 893 100.0
KOG0319|consensus 775 100.0
PLN00181793 protein SPA1-RELATED; Provisional 100.0
KOG0276|consensus 794 100.0
KOG0315|consensus311 100.0
KOG0266|consensus456 100.0
KOG0293|consensus519 100.0
KOG0319|consensus 775 100.0
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 100.0
KOG0278|consensus334 100.0
KOG0291|consensus 893 100.0
KOG0318|consensus603 100.0
KOG0276|consensus 794 100.0
KOG0305|consensus484 100.0
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 100.0
KOG0292|consensus 1202 100.0
KOG0643|consensus327 100.0
KOG0274|consensus537 100.0
KOG0645|consensus312 100.0
PLN00181793 protein SPA1-RELATED; Provisional 100.0
KOG0294|consensus362 100.0
KOG0285|consensus460 100.0
KOG0265|consensus338 100.0
KOG0277|consensus311 100.0
KOG0296|consensus399 100.0
KOG0275|consensus508 100.0
KOG0316|consensus307 100.0
KOG0264|consensus422 99.98
PTZ00420 568 coronin; Provisional 99.98
KOG0318|consensus 603 99.98
KOG1332|consensus299 99.98
KOG0292|consensus 1202 99.98
PTZ00421 493 coronin; Provisional 99.98
KOG0283|consensus 712 99.98
KOG0274|consensus537 99.97
KOG1407|consensus313 99.97
KOG0313|consensus423 99.97
KOG0640|consensus430 99.97
KOG0306|consensus 888 99.97
KOG0288|consensus459 99.97
PTZ00421 493 coronin; Provisional 99.97
KOG0310|consensus 487 99.97
KOG0308|consensus 735 99.97
KOG0301|consensus 745 99.97
KOG0310|consensus 487 99.97
KOG0772|consensus 641 99.97
KOG0289|consensus506 99.97
PTZ00420 568 coronin; Provisional 99.97
KOG0641|consensus350 99.97
KOG1446|consensus311 99.97
KOG0641|consensus350 99.96
KOG0306|consensus 888 99.96
KOG0268|consensus 433 99.96
KOG0293|consensus519 99.96
KOG0646|consensus 476 99.96
KOG0299|consensus479 99.96
KOG1036|consensus323 99.96
KOG0300|consensus481 99.96
KOG2445|consensus361 99.96
KOG0282|consensus503 99.96
KOG0283|consensus 712 99.96
KOG0973|consensus 942 99.96
KOG0269|consensus 839 99.96
KOG0301|consensus 745 99.96
KOG0647|consensus347 99.96
KOG0299|consensus479 99.96
KOG0275|consensus508 99.96
KOG1332|consensus299 99.96
KOG0308|consensus 735 99.96
KOG0300|consensus481 99.96
KOG0973|consensus 942 99.96
KOG0264|consensus422 99.95
KOG0772|consensus 641 99.95
KOG0302|consensus440 99.95
KOG0647|consensus347 99.95
KOG0289|consensus506 99.95
KOG0643|consensus 327 99.95
KOG2096|consensus420 99.95
KOG0268|consensus433 99.95
KOG0302|consensus440 99.94
KOG0639|consensus705 99.94
KOG1408|consensus 1080 99.94
KOG1407|consensus313 99.94
KOG4283|consensus397 99.94
KOG0278|consensus334 99.94
KOG0640|consensus430 99.94
KOG1036|consensus323 99.94
KOG0267|consensus 825 99.94
KOG0305|consensus484 99.94
KOG1274|consensus 933 99.94
KOG1274|consensus 933 99.93
KOG0321|consensus 720 99.93
KOG0646|consensus 476 99.93
KOG0269|consensus 839 99.93
KOG0639|consensus705 99.93
KOG0270|consensus463 99.93
KOG0267|consensus 825 99.93
KOG2048|consensus 691 99.93
KOG0294|consensus 362 99.93
KOG0307|consensus 1049 99.93
KOG1539|consensus 910 99.92
KOG2445|consensus 361 99.92
KOG1034|consensus385 99.92
KOG1446|consensus311 99.92
KOG2106|consensus 626 99.91
KOG4378|consensus 673 99.91
KOG4328|consensus498 99.91
KOG1408|consensus 1080 99.91
KOG4283|consensus 397 99.91
KOG0270|consensus463 99.91
KOG2055|consensus514 99.91
KOG0288|consensus459 99.91
KOG2096|consensus 420 99.9
KOG0650|consensus733 99.9
KOG1063|consensus 764 99.9
KOG2048|consensus 691 99.9
KOG1273|consensus405 99.9
KOG4328|consensus498 99.9
KOG2106|consensus 626 99.9
KOG0322|consensus323 99.89
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.89
KOG4378|consensus 673 99.89
KOG0290|consensus364 99.89
KOG0642|consensus577 99.89
KOG0321|consensus 720 99.88
KOG1539|consensus 910 99.88
KOG0303|consensus 472 99.88
KOG1188|consensus376 99.87
KOG1007|consensus370 99.87
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.87
KOG0307|consensus 1049 99.87
KOG0649|consensus325 99.86
KOG1587|consensus555 99.86
KOG1445|consensus 1012 99.86
KOG1009|consensus 434 99.86
KOG1063|consensus 764 99.86
KOG1007|consensus370 99.85
KOG2919|consensus406 99.85
KOG1273|consensus 405 99.84
KOG4227|consensus 609 99.84
KOG0303|consensus 472 99.84
KOG1538|consensus 1081 99.84
KOG1034|consensus385 99.83
COG2319 466 FOG: WD40 repeat [General function prediction only 99.83
KOG0644|consensus 1113 99.83
KOG2055|consensus514 99.82
KOG1587|consensus555 99.81
KOG2919|consensus406 99.81
KOG2394|consensus 636 99.8
KOG0649|consensus325 99.8
KOG0650|consensus733 99.8
KOG1523|consensus361 99.79
KOG0771|consensus398 99.79
KOG0290|consensus364 99.78
KOG1517|consensus1387 99.78
COG2319 466 FOG: WD40 repeat [General function prediction only 99.77
KOG1445|consensus 1012 99.77
PRK11028330 6-phosphogluconolactonase; Provisional 99.76
KOG1310|consensus 758 99.75
KOG1334|consensus 559 99.75
KOG1524|consensus 737 99.75
KOG1188|consensus 376 99.75
KOG1240|consensus1431 99.75
KOG1009|consensus434 99.74
KOG2110|consensus391 99.74
PRK01742429 tolB translocation protein TolB; Provisional 99.74
KOG1517|consensus1387 99.74
KOG1310|consensus 758 99.72
KOG1523|consensus 361 99.72
PRK01742429 tolB translocation protein TolB; Provisional 99.72
KOG0322|consensus323 99.72
PRK11028330 6-phosphogluconolactonase; Provisional 99.71
KOG1538|consensus 1081 99.71
KOG1963|consensus 792 99.71
KOG1240|consensus 1431 99.7
KOG1963|consensus 792 99.7
KOG2139|consensus445 99.7
KOG1524|consensus 737 99.69
KOG2110|consensus 391 99.69
KOG3881|consensus412 99.68
KOG0642|consensus577 99.68
KOG2111|consensus346 99.67
KOG1272|consensus 545 99.67
KOG4227|consensus 609 99.66
KOG1409|consensus404 99.65
KOG0644|consensus 1113 99.65
KOG1334|consensus559 99.64
KOG0771|consensus398 99.64
KOG2139|consensus 445 99.62
KOG1272|consensus 545 99.62
KOG2321|consensus 703 99.6
PRK03629429 tolB translocation protein TolB; Provisional 99.6
PRK05137435 tolB translocation protein TolB; Provisional 99.59
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.59
PRK02889427 tolB translocation protein TolB; Provisional 99.59
PF0815465 NLE: NLE (NUC135) domain; InterPro: IPR012972 This 99.58
PRK02889427 tolB translocation protein TolB; Provisional 99.58
KOG3881|consensus412 99.58
KOG2321|consensus 703 99.57
KOG2394|consensus 636 99.57
KOG2111|consensus346 99.57
PRK04922433 tolB translocation protein TolB; Provisional 99.56
KOG1354|consensus433 99.55
KOG0974|consensus 967 99.54
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.53
PRK03629429 tolB translocation protein TolB; Provisional 99.53
KOG1354|consensus433 99.5
KOG4547|consensus 541 99.5
PRK04922433 tolB translocation protein TolB; Provisional 99.49
KOG0974|consensus 967 99.49
PRK05137435 tolB translocation protein TolB; Provisional 99.49
KOG4497|consensus447 99.49
KOG0280|consensus339 99.46
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.44
KOG4497|consensus 447 99.43
PRK00178430 tolB translocation protein TolB; Provisional 99.43
KOG1409|consensus404 99.41
KOG1064|consensus2439 99.41
KOG4547|consensus 541 99.38
KOG0309|consensus 1081 99.37
PRK04792448 tolB translocation protein TolB; Provisional 99.36
KOG0280|consensus339 99.36
KOG1064|consensus2439 99.35
PRK01029428 tolB translocation protein TolB; Provisional 99.34
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.34
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.34
KOG2315|consensus 566 99.3
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.3
PRK01029428 tolB translocation protein TolB; Provisional 99.29
KOG4190|consensus1034 99.27
KOG2695|consensus425 99.25
PRK00178430 tolB translocation protein TolB; Provisional 99.24
KOG2041|consensus 1189 99.22
PRK04792448 tolB translocation protein TolB; Provisional 99.22
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 99.21
COG5170 460 CDC55 Serine/threonine protein phosphatase 2A, reg 99.19
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.16
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.15
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 99.14
PF02239 369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.14
KOG3914|consensus390 99.14
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.13
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 99.12
KOG4532|consensus344 99.08
KOG3914|consensus 390 99.04
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.03
KOG2114|consensus 933 99.03
KOG2066|consensus 846 99.03
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 99.01
KOG4532|consensus 344 99.01
KOG4714|consensus319 99.0
PRK04043419 tolB translocation protein TolB; Provisional 98.97
KOG4714|consensus319 98.96
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.93
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.93
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.92
KOG0309|consensus 1081 98.92
KOG2695|consensus425 98.9
COG4946668 Uncharacterized protein related to the periplasmic 98.9
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.89
KOG4190|consensus 1034 98.89
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.89
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.88
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.86
KOG1275|consensus 1118 98.84
KOG2315|consensus 566 98.82
KOG0882|consensus 558 98.81
KOG1275|consensus 1118 98.81
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 98.81
KOG1912|consensus 1062 98.78
KOG1912|consensus 1062 98.78
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 98.77
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.76
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.75
KOG1920|consensus 1265 98.73
KOG2041|consensus 1189 98.73
KOG1008|consensus 783 98.7
COG4946 668 Uncharacterized protein related to the periplasmic 98.69
KOG1832|consensus 1516 98.66
KOG1920|consensus 1265 98.61
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.61
KOG1832|consensus 1516 98.58
KOG0882|consensus 558 98.56
KOG2114|consensus 933 98.56
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 98.54
KOG2314|consensus 698 98.54
PRK04043419 tolB translocation protein TolB; Provisional 98.52
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.45
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.45
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.44
KOG4649|consensus354 98.44
KOG2314|consensus 698 98.43
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.42
KOG1008|consensus 783 98.41
KOG3621|consensus 726 98.38
PF04841 410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 98.33
KOG1645|consensus463 98.33
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.29
KOG3617|consensus 1416 98.29
KOG2066|consensus 846 98.2
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 98.14
KOG1645|consensus 463 98.13
PF08553 794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 98.1
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 98.08
PF08596 395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 98.05
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.96
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 97.96
PF03178 321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 97.93
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 97.86
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.83
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.82
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.8
KOG4640|consensus 665 97.62
KOG3621|consensus 726 97.61
PF08553 794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 97.59
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 97.58
PF08596 395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 97.57
PHA02713557 hypothetical protein; Provisional 97.54
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 97.53
PRK02888 635 nitrous-oxide reductase; Validated 97.51
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 97.48
KOG3617|consensus 1416 97.46
KOG4640|consensus 665 97.37
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.36
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 97.31
PRK02888 635 nitrous-oxide reductase; Validated 97.26
KOG4441|consensus571 97.22
KOG2079|consensus 1206 97.19
PF04841 410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 97.19
COG0823425 TolB Periplasmic component of the Tol biopolymer t 97.16
PHA02713557 hypothetical protein; Provisional 97.13
KOG2079|consensus 1206 97.13
KOG4649|consensus354 97.12
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 97.1
KOG2395|consensus 644 97.05
KOG2395|consensus644 97.04
KOG2444|consensus238 97.02
KOG2444|consensus238 96.93
PF14655 415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 96.93
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 96.88
COG3204316 Uncharacterized protein conserved in bacteria [Fun 96.85
KOG4441|consensus571 96.83
COG0823425 TolB Periplasmic component of the Tol biopolymer t 96.83
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 96.74
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 96.74
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 96.71
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 96.61
COG3391381 Uncharacterized conserved protein [Function unknow 96.54
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 96.48
PRK13616591 lipoprotein LpqB; Provisional 96.44
PHA03098534 kelch-like protein; Provisional 96.43
PRK13616591 lipoprotein LpqB; Provisional 96.41
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 96.4
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 96.39
COG3391381 Uncharacterized conserved protein [Function unknow 96.28
COG3386 307 Gluconolactonase [Carbohydrate transport and metab 96.07
KOG1916|consensus 1283 96.06
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 96.04
PF14727 418 PHTB1_N: PTHB1 N-terminus 95.98
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 95.98
KOG2280|consensus 829 95.94
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 95.92
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 95.87
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 95.86
TIGR02604 367 Piru_Ver_Nterm putative membrane-bound dehydrogena 95.82
PF05694 461 SBP56: 56kDa selenium binding protein (SBP56); Int 95.67
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 95.66
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 95.64
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 95.64
KOG3630|consensus 1405 95.61
PHA03098534 kelch-like protein; Provisional 95.55
PF00930 353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 95.54
TIGR02604 367 Piru_Ver_Nterm putative membrane-bound dehydrogena 95.49
KOG1916|consensus 1283 95.48
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 95.33
PRK13684334 Ycf48-like protein; Provisional 95.3
KOG1897|consensus 1096 95.17
PHA02790480 Kelch-like protein; Provisional 95.07
KOG4499|consensus310 95.03
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 94.92
KOG1897|consensus 1096 94.86
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 94.74
PHA02790480 Kelch-like protein; Provisional 94.58
KOG1900|consensus 1311 94.46
COG3204316 Uncharacterized protein conserved in bacteria [Fun 94.31
COG3386307 Gluconolactonase [Carbohydrate transport and metab 94.3
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 94.26
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 94.04
COG5276370 Uncharacterized conserved protein [Function unknow 93.99
KOG4499|consensus310 93.62
PF10647 253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 93.26
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 93.22
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 92.88
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 92.63
COG5276370 Uncharacterized conserved protein [Function unknow 92.59
KOG3630|consensus 1405 92.31
KOG1983|consensus 993 92.14
KOG4460|consensus 741 92.13
COG3490366 Uncharacterized protein conserved in bacteria [Fun 92.12
COG5167 776 VID27 Protein involved in vacuole import and degra 92.07
KOG2377|consensus 657 92.04
PLN02153341 epithiospecifier protein 91.85
PF07995 331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 91.71
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 91.61
KOG4460|consensus 741 91.09
KOG2377|consensus 657 91.08
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 90.97
PF02333381 Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 90.94
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 90.9
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 90.61
PF1234127 DUF3639: Protein of unknown function (DUF3639) ; I 90.6
COG5167776 VID27 Protein involved in vacuole import and degra 90.55
KOG2247|consensus 615 90.44
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 88.93
KOG2247|consensus 615 88.77
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 88.66
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 88.55
KOG1900|consensus 1311 88.24
COG4590 733 ABC-type uncharacterized transport system, permeas 87.84
KOG3616|consensus 1636 87.83
KOG3522|consensus 925 87.65
PF0767639 PD40: WD40-like Beta Propeller Repeat; InterPro: I 87.47
PF12657173 TFIIIC_delta: Transcription factor IIIC subunit de 87.23
PF12657173 TFIIIC_delta: Transcription factor IIIC subunit de 86.57
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 86.33
PF08801 422 Nucleoporin_N: Nup133 N terminal like; InterPro: I 85.3
COG3490366 Uncharacterized protein conserved in bacteria [Fun 85.05
PF14583 386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 85.05
smart0056433 PQQ beta-propeller repeat. Beta-propeller repeat o 85.0
PF11635 753 Med16: Mediator complex subunit 16; InterPro: IPR0 84.89
PF11715 547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 84.57
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 84.55
PF11715 547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 84.51
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 84.42
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 84.33
PF13449326 Phytase-like: Esterase-like activity of phytase 84.04
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 83.6
PF0101138 PQQ: PQQ enzyme repeat family.; InterPro: IPR00237 82.95
PLN02153341 epithiospecifier protein 82.69
PLN00033398 photosystem II stability/assembly factor; Provisio 82.66
COG5308 1263 NUP170 Nuclear pore complex subunit [Intracellular 82.57
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 82.31
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 81.05
PRK13684334 Ycf48-like protein; Provisional 81.05
PF02333381 Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 80.91
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 80.45
>KOG0313|consensus Back     alignment and domain information
Probab=100.00  E-value=2e-69  Score=433.42  Aligned_cols=373  Identities=45%  Similarity=0.890  Sum_probs=337.1

Q ss_pred             CCceEEEEEEeCCCccccCCceEEEecCCCcchHHHHHHHHhccCCCCCCCCCceeeEEeCCeEehhhHHHHHHHcCCCc
Q psy2107          13 VPSEVQLKFFTKQEKYAVPDLVFAVQGNLGVPGLNSLINEILKEDSNEDNYKDIQFDFLIAGELLRTSVTSFLESKGISS   92 (391)
Q Consensus        13 ~~~~v~~~~~~~~~~~~~~~~~~~ip~~~~~~~~~~~~~~ll~~~~~~~~~~~~~~~f~~~~~~l~~~~~~~l~~~~~~~   92 (391)
                      ..++||++|+|+++.|++|+.||.||++.++++|+.++|+||+.++..-++  .||+|++.|++|++++.+||...++++
T Consensus         4 ~~~qvqvrF~Tk~e~~aVpD~p~~iP~~~~r~gLs~ivN~ll~se~~~~K~--~pFDFLi~gelLRtsL~e~l~~kgiSs   81 (423)
T KOG0313|consen    4 NSGQVQVRFFTKNEDYAVPDVPFAIPTSVERYGLSNIVNKLLKSENGFWKP--VPFDFLIKGELLRTSLDEHLEEKGISS   81 (423)
T ss_pred             CcceEEEEEEecccccCCCCcceeccCcceEccHHHHHHHHHhccCCcCCC--CcceEEEcceeeeccHHHHHHHcCcCh
Confidence            468999999999889999999999999999999999999999998877777  999999999999999999999999999


Q ss_pred             cceEEEEEEeccCCCCCCcccCCCCcEEEEEecCCEEEEEECCCeEEEEcCCCceEEeccCCCCCeeEEEEEecCCCCeE
Q psy2107          93 ENVIDVEYLESTPTPSPLDCILHDDWVSAIDFHNDWILTGCYDHSVHIWTRRGEHKLNIPGHGGPVKGVAWLYNDGKDAA  172 (391)
Q Consensus        93 ~~~~~~~~~~~~~~~~~~~~~~h~~~V~~~~~~~~~l~t~~~dg~i~iwd~~~~~~~~~~~~~~~v~~l~~~~~~~~~~~  172 (391)
                      |..++++|.+...+|.++.++.|.++|.++...++.+++|++||.+++||..|+....+.+|.++|.+++|.-.++....
T Consensus        82 E~~leIEYv~~~~aP~pl~~~~hdDWVSsv~~~~~~IltgsYDg~~riWd~~Gk~~~~~~Ght~~ik~v~~v~~n~~~~~  161 (423)
T KOG0313|consen   82 EEILEIEYVEAITAPKPLQCFLHDDWVSSVKGASKWILTGSYDGTSRIWDLKGKSIKTIVGHTGPIKSVAWVIKNSSSCL  161 (423)
T ss_pred             hheeEEEEEEecCCCCccccccchhhhhhhcccCceEEEeecCCeeEEEecCCceEEEEecCCcceeeeEEEecCCccce
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999766566668


Q ss_pred             EEEEeCCCcEEEEeecCCCCceeEEEEEecCCCCeEEEEEcCCCCEEEEEeCCCcEEEEECCCCCCCCCCCCCCCCCccc
Q psy2107         173 FISVSTDQTAMIWEWKVESNSIECIHVCRGHERGLETVTVSESRQQFATGGWDCLLKIWSADISKERGDPSENGDEGTTS  252 (391)
Q Consensus       173 l~s~~~dg~v~iwd~~~~~~~~~~~~~~~~~~~~v~~l~~~~~~~~l~sg~~dg~i~iwd~~~~~~~~~~~~~~~~~~~~  252 (391)
                      |++++.|.++++|.++........+....||...|.+++..+++..+++|+.|..|++|+..+.........    ....
T Consensus       162 fvsas~Dqtl~Lw~~~~~~~~~~~~~~~~GHk~~V~sVsv~~sgtr~~SgS~D~~lkiWs~~~~~~~~~E~~----s~~r  237 (423)
T KOG0313|consen  162 FVSASMDQTLRLWKWNVGENKVKALKVCRGHKRSVDSVSVDSSGTRFCSGSWDTMLKIWSVETDEEDELESS----SNRR  237 (423)
T ss_pred             EEEecCCceEEEEEecCchhhhhHHhHhcccccceeEEEecCCCCeEEeecccceeeecccCCCcccccccc----chhh
Confidence            999999999999999877776777777779999999999999999999999999999999433221100000    0011


Q ss_pred             cccccccccCCCCCceeeecCccCcccEEEeccCCeEEEEECCCeEEEEecccCceeEEEECCeeeEEEEECCCCCEEEE
Q psy2107         253 KKRKKEYSSASSRTPLITLKGHKEAISAVQWTAVDEIITSSWDHTLKIWDAELGGMKSEIVGNKSFFDVHYSPLSKLVIT  332 (391)
Q Consensus       253 ~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~l~s~~~dg~i~iwd~~~~~~~~~~~~~~~i~~~~~~p~~~~l~~  332 (391)
                      .+..........+.|+..+.+|..+|.++.|++...+++++.|.+|+.||+.++....++.+...+.++.++|..++|++
T Consensus       238 rk~~~~~~~~~~r~P~vtl~GHt~~Vs~V~w~d~~v~yS~SwDHTIk~WDletg~~~~~~~~~ksl~~i~~~~~~~Ll~~  317 (423)
T KOG0313|consen  238 RKKQKREKEGGTRTPLVTLEGHTEPVSSVVWSDATVIYSVSWDHTIKVWDLETGGLKSTLTTNKSLNCISYSPLSKLLAS  317 (423)
T ss_pred             hhhhhhhhcccccCceEEecccccceeeEEEcCCCceEeecccceEEEEEeecccceeeeecCcceeEeecccccceeee
Confidence            11112233456688999999999999999999989999999999999999999999999999999999999999999999


Q ss_pred             eeCCCcEEEEcCCCCCcceEEEEeccccCcEEEEEECCCCCCEEEEeeCCCcEEEEecC
Q psy2107         333 ASADKQIRLYDPKVKEGAIVKSTFSSHKEWVQSVRWSPIDPQLFVSASFDNSVKLWDLR  391 (391)
Q Consensus       333 g~~dg~i~iwd~~~~~~~~~~~~~~~h~~~v~~~~~~~~~~~~l~s~~~dg~v~iwdlr  391 (391)
                      |+.|..|++||++++.+..+...+.+|.+.|.++.|+|.+.++|++++.|+++++||+|
T Consensus       318 gssdr~irl~DPR~~~gs~v~~s~~gH~nwVssvkwsp~~~~~~~S~S~D~t~klWDvR  376 (423)
T KOG0313|consen  318 GSSDRHIRLWDPRTGDGSVVSQSLIGHKNWVSSVKWSPTNEFQLVSGSYDNTVKLWDVR  376 (423)
T ss_pred             cCCCCceeecCCCCCCCceeEEeeecchhhhhheecCCCCceEEEEEecCCeEEEEEec
Confidence            99999999999999998889999999999999999999999999999999999999997



>KOG0271|consensus Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08154 NLE: NLE (NUC135) domain; InterPro: IPR012972 This domain is located N-terminal to WD40 repeats(IPR001680 from INTERPRO) Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>KOG2280|consensus Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>KOG1897|consensus Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>KOG1897|consensus Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG1900|consensus Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>KOG1983|consensus Back     alignment and domain information
>KOG4460|consensus Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2377|consensus Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>KOG4460|consensus Back     alignment and domain information
>KOG2377|consensus Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PF12341 DUF3639: Protein of unknown function (DUF3639) ; InterPro: IPR022100 This domain family is found in eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2247|consensus Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>KOG2247|consensus Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>KOG1900|consensus Back     alignment and domain information
>COG4590 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>KOG3616|consensus Back     alignment and domain information
>KOG3522|consensus Back     alignment and domain information
>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PF12657 TFIIIC_delta: Transcription factor IIIC subunit delta N-term; InterPro: IPR024761 This entry represents a domain found towards the N terminus of the 90 kDa subunit of transcription factor IIIC (also known as subunit 9 in yeast []) Back     alignment and domain information
>PF12657 TFIIIC_delta: Transcription factor IIIC subunit delta N-term; InterPro: IPR024761 This entry represents a domain found towards the N terminus of the 90 kDa subunit of transcription factor IIIC (also known as subunit 9 in yeast []) Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PF08801 Nucleoporin_N: Nup133 N terminal like; InterPro: IPR014908 Nucleoporins are the main components of the nuclear pore complex (NPC) in eukaryotic cells, and mediate bidirectional nucleocytoplasmic transport, especially of mRNA and proteins Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>smart00564 PQQ beta-propeller repeat Back     alignment and domain information
>PF11635 Med16: Mediator complex subunit 16; InterPro: IPR021665 Mediator is a large complex of up to 33 proteins that is conserved from plants through fungi to humans - the number and representation of individual subunits varying with species [],[] Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PF01011 PQQ: PQQ enzyme repeat family Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>COG5308 NUP170 Nuclear pore complex subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query391
2ymu_A577 Structure Of A Highly Repetitive Propeller Structur 7e-15
2ovp_B445 Structure Of The Skp1-Fbw7 Complex Length = 445 4e-14
2ovp_B 445 Structure Of The Skp1-Fbw7 Complex Length = 445 6e-04
2cnx_A315 Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2. 7e-13
2cnx_A 315 Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2. 2e-12
2co0_A315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 7e-13
2co0_A 315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 2e-12
2h9l_A329 Wdr5delta23 Length = 329 7e-13
3n0e_A315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 8e-13
3n0e_A 315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 4e-12
2g99_A308 Structural Basis For The Specific Recognition Of Me 8e-13
2g99_A 308 Structural Basis For The Specific Recognition Of Me 5e-12
2g9a_A311 Structural Basis For The Specific Recognition Of Me 8e-13
2g9a_A 311 Structural Basis For The Specific Recognition Of Me 4e-12
2gnq_A336 Structure Of Wdr5 Length = 336 8e-13
3emh_A318 Structural Basis Of Wdr5-Mll Interaction Length = 3 8e-13
3n0d_A315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 8e-13
3n0d_A 315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 4e-12
2xl2_A334 Wdr5 In Complex With An Rbbp5 Peptide Recruited To 8e-13
3psl_A318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 8e-13
4a7j_A318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 8e-13
3smr_A312 Crystal Structure Of Human Wd Repeat Domain 5 With 8e-13
2h68_A312 Histone H3 Recognition And Presentation By The Wdr5 9e-13
2h9m_A313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 9e-13
2h13_A317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 9e-13
3mxx_A315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 1e-12
3mxx_A 315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 6e-12
1nex_B464 Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Comp 1e-12
3mks_B464 Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH 2e-12
3zey_7 318 High-resolution Cryo-electron Microscopy Structure 2e-12
2xzm_R 343 Crystal Structure Of The Eukaryotic 40s Ribosomal S 2e-10
1vyh_C410 Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 6e-10
1vyh_C 410 Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 5e-07
1p22_A435 Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex 5e-09
1p22_A 435 Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex 2e-06
3fm0_A345 Crystal Structure Of Wd40 Protein Ciao1 Length = 34 8e-09
4a11_B 408 Structure Of The Hsddb1-Hscsa Complex Length = 408 1e-08
2bcj_B340 Crystal Structure Of G Protein-coupled Receptor Kin 4e-08
3rfg_A 319 Crystal Structure Of The Yeast Rack1 Dimer In Space 4e-08
3rfh_A 319 Crystal Structure Of The Yeast Rack1 Dimer In Space 4e-08
3sn6_B351 Crystal Structure Of The Beta2 Adrenergic Receptor- 4e-08
1gg2_B340 G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Bet 4e-08
1trj_A 314 Homology Model Of Yeast Rack1 Protein Fitted Into 1 4e-08
3izb_a 319 Localization Of The Small Subunit Ribosomal Protein 4e-08
3jyv_R 313 Structure Of The 40s Rrna And Proteins And PE TRNA 4e-08
1a0r_B340 Heterotrimeric Complex Of PhosducinTRANSDUCIN BETA- 4e-08
1got_B340 Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimer 5e-08
3frx_A 319 Crystal Structure Of The Yeast Orthologue Of Rack1, 1e-07
1erj_A 393 Crystal Structure Of The C-Terminal Wd40 Domain Of 2e-07
2pbi_B354 The Multifunctional Nature Of Gbeta5RGS9 REVEALED F 4e-07
3iz6_a 380 Localization Of The Small Subunit Ribosomal Protein 4e-07
3shf_A 1256 Crystal Structure Of The R265s Mutant Of Full-Lengt 8e-07
3sfz_A 1249 Crystal Structure Of Full-Length Murine Apaf-1 Leng 8e-07
3dm0_A694 Maltose Binding Protein Fusion With Rack1 From A. T 9e-07
3cfv_B 414 Structural Basis Of The Interaction Of Rbap46RBAP48 2e-06
3cfs_B 414 Structural Basis Of The Interaction Of Rbap46RBAP48 2e-06
3ow8_A321 Crystal Structure Of The Wd Repeat-Containing Prote 6e-06
2hes_X330 Cytosolic Iron-sulphur Assembly Protein- 1 Length = 6e-06
4aow_A340 Crystal Structure Of The Human Rack1 Protein At A R 7e-06
2zkq_a317 Structure Of A Mammalian Ribosomal 40s Subunit With 7e-06
3gfc_A 425 Crystal Structure Of Histone-Binding Protein Rbbp4 2e-05
2yba_A 422 Crystal Structure Of Nurf55 In Complex With Histone 2e-05
2b4e_A 402 Crystal Structure Of Murine Coronin-1: Monoclinic F 2e-05
3c99_A 432 Structural Basis Of Histone H4 Recognition By P55 L 2e-05
2xyi_A 430 Crystal Structure Of Nurf55 In Complex With A H4 Pe 2e-05
3mkq_A 814 Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subco 2e-05
2ynp_A 604 Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 3e-05
2aq5_A 402 Crystal Structure Of Murine Coronin-1 Length = 402 3e-05
3iza_B 1263 Structure Of An Apoptosome-Procaspase-9 Card Comple 4e-05
2yno_A310 Yeast Betaprime Cop 1-304h6 Length = 310 5e-05
2ynn_A304 Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 5e-05
3odt_A313 Crystal Structure Of Wd40 Beta Propeller Domain Of 2e-04
>pdb|2YMU|A Chain A, Structure Of A Highly Repetitive Propeller Structure Length = 577 Back     alignment and structure

Iteration: 1

Score = 78.2 bits (191), Expect = 7e-15, Method: Compositional matrix adjust. Identities = 74/263 (28%), Positives = 118/263 (44%), Gaps = 46/263 (17%) Query: 129 ILTGCYDHSVHIWTRRGEHKLNIPGHGGPVKGVAWLYNDGKDAAFISVSTDQTAMIWEWK 188 I + D +V +W R G+H + GH V GVA DG+ A S S D+T +W Sbjct: 318 IASASDDKTVKLWNRNGQHLQTLTGHSSSVWGVA-FSPDGQTIA--SASDDKTVKLWN-- 372 Query: 189 VESNSIECIHVCRGHERGLETVTVSESRQQFATGGWDCLLKIWSADISKERGDPSENGDE 248 + + + GH + V S Q A+ D +K+W + NG Sbjct: 373 ---RNGQLLQTLTGHSSSVRGVAFSPDGQTIASASDDKTVKLW-----------NRNGQ- 417 Query: 249 GTTSKKRKKEYSSASSRTPLITLKGHKEAISAVQWTAVDEIITS-SWDHTLKIWDAELGG 307 L TL GH ++ V ++ D+ I S S D T+K+W+ G Sbjct: 418 ------------------LLQTLTGHSSSVWGVAFSPDDQTIASASDDKTVKLWNRN-GQ 458 Query: 308 MKSEIVG-NKSFFDVHYSPLSKLVITASADKQIRLYDPKVKEGAIVKSTFSSHKEWVQSV 366 + + G + S V +SP + + +AS DK ++L++ + G +++ T + H V+ V Sbjct: 459 LLQTLTGHSSSVRGVAFSPDGQTIASASDDKTVKLWN---RNGQLLQ-TLTGHSSSVRGV 514 Query: 367 RWSPIDPQLFVSASFDNSVKLWD 389 +SP D Q SAS D +VKLW+ Sbjct: 515 AFSP-DGQTIASASDDKTVKLWN 536
>pdb|2OVP|B Chain B, Structure Of The Skp1-Fbw7 Complex Length = 445 Back     alignment and structure
>pdb|2OVP|B Chain B, Structure Of The Skp1-Fbw7 Complex Length = 445 Back     alignment and structure
>pdb|2CNX|A Chain A, Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.1 Angstrom Length = 315 Back     alignment and structure
>pdb|2CNX|A Chain A, Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.1 Angstrom Length = 315 Back     alignment and structure
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|2GNQ|A Chain A, Structure Of Wdr5 Length = 336 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|2XL2|A Chain A, Wdr5 In Complex With An Rbbp5 Peptide Recruited To Novel Site Length = 334 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|1NEX|B Chain B, Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Complex Length = 464 Back     alignment and structure
>pdb|3MKS|B Chain B, Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH AN ALLOSTERIC Inhibitor Scf-I2 Length = 464 Back     alignment and structure
>pdb|3ZEY|7 Chain 7, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 318 Back     alignment and structure
>pdb|2XZM|R Chain R, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit In Complex With Initiation Factor 1. This File Contains The 40s Subunit And Initiation Factor For Molecule 1 Length = 343 Back     alignment and structure
>pdb|1VYH|C Chain C, Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 Back     alignment and structure
>pdb|1VYH|C Chain C, Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 Back     alignment and structure
>pdb|1P22|A Chain A, Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex: Destruction Motif Binding And Lysine Specificity On The Scfbeta-Trcp1 Ubiquitin Ligase Length = 435 Back     alignment and structure
>pdb|1P22|A Chain A, Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex: Destruction Motif Binding And Lysine Specificity On The Scfbeta-Trcp1 Ubiquitin Ligase Length = 435 Back     alignment and structure
>pdb|3FM0|A Chain A, Crystal Structure Of Wd40 Protein Ciao1 Length = 345 Back     alignment and structure
>pdb|4A11|B Chain B, Structure Of The Hsddb1-Hscsa Complex Length = 408 Back     alignment and structure
>pdb|2BCJ|B Chain B, Crystal Structure Of G Protein-coupled Receptor Kinase 2 In Complex With Galpha-q And Gbetagamma Subunits Length = 340 Back     alignment and structure
>pdb|3RFG|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P63 Length = 319 Back     alignment and structure
>pdb|3RFH|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P21 Length = 319 Back     alignment and structure
>pdb|3SN6|B Chain B, Crystal Structure Of The Beta2 Adrenergic Receptor-Gs Protein Complex Length = 351 Back     alignment and structure
>pdb|1GG2|B Chain B, G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Beta_1 Gamma_2 With Gdp Bound Length = 340 Back     alignment and structure
>pdb|1TRJ|A Chain A, Homology Model Of Yeast Rack1 Protein Fitted Into 11.7a Cryo-em Map Of Yeast 80s Ribosome Length = 314 Back     alignment and structure
>pdb|3IZB|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 319 Back     alignment and structure
>pdb|3JYV|R Chain R, Structure Of The 40s Rrna And Proteins And PE TRNA FOR EUKARYOTIC Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 313 Back     alignment and structure
>pdb|1A0R|B Chain B, Heterotrimeric Complex Of PhosducinTRANSDUCIN BETA-Gamma Length = 340 Back     alignment and structure
>pdb|1GOT|B Chain B, Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimera And The Gt-Beta-Gamma Subunits Length = 340 Back     alignment and structure
>pdb|3FRX|A Chain A, Crystal Structure Of The Yeast Orthologue Of Rack1, Asc1. Length = 319 Back     alignment and structure
>pdb|1ERJ|A Chain A, Crystal Structure Of The C-Terminal Wd40 Domain Of Tup1 Length = 393 Back     alignment and structure
>pdb|2PBI|B Chain B, The Multifunctional Nature Of Gbeta5RGS9 REVEALED FROM ITS CRYSTAL Structure Length = 354 Back     alignment and structure
>pdb|3IZ6|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 380 Back     alignment and structure
>pdb|3SHF|A Chain A, Crystal Structure Of The R265s Mutant Of Full-Length Murine Apaf-1 Length = 1256 Back     alignment and structure
>pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249 Back     alignment and structure
>pdb|3DM0|A Chain A, Maltose Binding Protein Fusion With Rack1 From A. Thaliana Length = 694 Back     alignment and structure
>pdb|3CFV|B Chain B, Structural Basis Of The Interaction Of Rbap46RBAP48 WITH Histone H4 Length = 414 Back     alignment and structure
>pdb|3CFS|B Chain B, Structural Basis Of The Interaction Of Rbap46RBAP48 WITH Histone H4 Length = 414 Back     alignment and structure
>pdb|3OW8|A Chain A, Crystal Structure Of The Wd Repeat-Containing Protein 61 Length = 321 Back     alignment and structure
>pdb|2HES|X Chain X, Cytosolic Iron-sulphur Assembly Protein- 1 Length = 330 Back     alignment and structure
>pdb|4AOW|A Chain A, Crystal Structure Of The Human Rack1 Protein At A Resolution Of 2.45 Angstrom Length = 340 Back     alignment and structure
>pdb|2ZKQ|AA Chain a, Structure Of A Mammalian Ribosomal 40s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 317 Back     alignment and structure
>pdb|3GFC|A Chain A, Crystal Structure Of Histone-Binding Protein Rbbp4 Length = 425 Back     alignment and structure
>pdb|2YBA|A Chain A, Crystal Structure Of Nurf55 In Complex With Histone H3 Length = 422 Back     alignment and structure
>pdb|2B4E|A Chain A, Crystal Structure Of Murine Coronin-1: Monoclinic Form Length = 402 Back     alignment and structure
>pdb|3C99|A Chain A, Structural Basis Of Histone H4 Recognition By P55 Length = 432 Back     alignment and structure
>pdb|2XYI|A Chain A, Crystal Structure Of Nurf55 In Complex With A H4 Peptide Length = 430 Back     alignment and structure
>pdb|3MKQ|A Chain A, Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subcomplex Of The Copi Vesicular Coat Length = 814 Back     alignment and structure
>pdb|2YNP|A Chain A, Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 604 Back     alignment and structure
>pdb|2AQ5|A Chain A, Crystal Structure Of Murine Coronin-1 Length = 402 Back     alignment and structure
>pdb|2YNO|A Chain A, Yeast Betaprime Cop 1-304h6 Length = 310 Back     alignment and structure
>pdb|2YNN|A Chain A, Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 304 Back     alignment and structure
>pdb|3ODT|A Chain A, Crystal Structure Of Wd40 Beta Propeller Domain Of Doa1 Length = 313 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query391
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 100.0
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
3jrp_A379 Fusion protein of protein transport protein SEC13 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 100.0
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 100.0
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 100.0
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
4e54_B435 DNA damage-binding protein 2; beta barrel, double 100.0
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 100.0
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 100.0
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 100.0
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 100.0
2xyi_A430 Probable histone-binding protein CAF1; transcripti 100.0
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 100.0
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
3jro_A 753 Fusion protein of protein transport protein SEC13 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 100.0
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 100.0
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 100.0
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 100.0
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 100.0
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 100.0
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 100.0
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 100.0
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 100.0
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 100.0
3iz6_a 380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 100.0
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 100.0
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 100.0
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 100.0
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 100.0
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 100.0
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 100.0
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 100.0
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 100.0
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 100.0
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 100.0
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 100.0
3jrp_A 379 Fusion protein of protein transport protein SEC13 100.0
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.98
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.98
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.98
3f3f_A 351 Nucleoporin SEH1; structural protein, protein comp 99.97
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.97
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.97
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.97
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 99.97
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.97
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.97
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.97
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.97
3jro_A 753 Fusion protein of protein transport protein SEC13 99.97
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.97
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.97
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.97
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.96
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.96
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.96
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.95
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.95
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.95
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.92
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.91
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.9
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.9
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.9
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 99.89
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.89
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.89
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.89
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.89
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.89
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.88
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.88
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.88
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.87
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.87
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.86
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.86
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.86
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.85
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.85
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.84
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.84
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.83
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.83
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.82
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.81
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.81
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.81
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.8
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.79
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.77
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.77
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.74
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.74
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.72
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.7
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.69
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.69
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.69
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.68
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.68
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.68
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.67
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.67
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.67
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.66
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.65
3pe7_A 388 Oligogalacturonate lyase; seven-bladed beta-propel 99.64
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.62
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.62
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 99.61
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.59
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.59
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.58
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.58
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.57
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 99.57
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.57
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.55
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.54
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.53
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.53
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.52
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.51
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.5
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.5
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.47
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.46
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.45
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.43
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.42
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 99.41
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.4
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.4
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 99.39
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.37
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.37
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.34
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.28
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.27
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.26
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.25
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.25
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.19
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 99.17
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 99.12
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.11
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.1
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 99.09
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.08
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 99.06
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.04
2qe8_A343 Uncharacterized protein; structural genomics, join 99.03
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.96
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.96
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.95
2ece_A 462 462AA long hypothetical selenium-binding protein; 98.93
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 98.92
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 98.91
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.9
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.89
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 98.87
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.87
2qe8_A343 Uncharacterized protein; structural genomics, join 98.86
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.84
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.83
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 98.83
2ece_A462 462AA long hypothetical selenium-binding protein; 98.82
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.71
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.69
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.69
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 98.67
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.66
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.66
4a2l_A 795 BT_4663, two-component system sensor histidine kin 98.66
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.64
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.6
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.6
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.57
4a2l_A 795 BT_4663, two-component system sensor histidine kin 98.56
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.55
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.54
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.49
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 98.48
3v9f_A 781 Two-component system sensor histidine kinase/RESP 98.46
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.44
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 98.44
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 98.43
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 98.41
3v9f_A 781 Two-component system sensor histidine kinase/RESP 98.38
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 98.35
3v65_B386 Low-density lipoprotein receptor-related protein; 98.33
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.28
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 98.27
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 98.25
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 98.24
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 98.19
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 98.12
2p9w_A 334 MAL S 1 allergenic protein; beta propeller; 1.35A 98.08
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 98.06
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 98.06
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 98.05
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 98.05
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 98.04
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 97.97
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 97.97
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 97.93
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.92
2p4o_A 306 Hypothetical protein; putative lactonase, structur 97.9
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 97.88
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 97.84
3tc9_A 430 Hypothetical hydrolase; 6-bladed beta-propeller, i 97.82
3v64_C 349 Agrin; beta propeller, laminin-G, signaling, prote 97.8
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.8
3ei3_A 1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 97.8
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 97.8
3v65_B 386 Low-density lipoprotein receptor-related protein; 97.77
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 97.74
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 97.73
1ijq_A 316 LDL receptor, low-density lipoprotein receptor; be 97.61
3sov_A 318 LRP-6, low-density lipoprotein receptor-related pr 97.53
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 97.52
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 97.5
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 97.5
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 97.49
3p5b_L400 Low density lipoprotein receptor variant; B-propel 97.35
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 97.33
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 97.32
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 97.31
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 97.3
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 97.27
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 97.23
3kya_A 496 Putative phosphatase; structural genomics, joint c 97.05
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 97.05
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 97.05
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 96.99
3ei3_A 1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 96.93
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 96.88
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 96.84
1bpo_A 494 Protein (clathrin); clathrin endocytosis beta-prop 96.81
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 96.8
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 96.75
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 96.71
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 96.59
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 96.58
3kya_A496 Putative phosphatase; structural genomics, joint c 96.55
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 96.53
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 96.5
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 96.32
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 96.32
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 96.2
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 96.09
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 96.08
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 96.05
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 95.99
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 95.76
2be1_A339 Serine/threonine-protein kinase/endoribonuclease; 95.68
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 95.63
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 95.53
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 95.49
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 95.45
3a9g_A 354 Putative uncharacterized protein; PQQ dependent de 95.41
3ott_A 758 Two-component system sensor histidine kinase; beta 95.4
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 95.34
2g8s_A 353 Glucose/sorbosone dehydrogenases; bladed beta-prop 95.31
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 95.2
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 94.97
3qhy_B282 Beta-lactamase inhibitory protein II; enyzme-inhib 94.97
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 94.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 93.92
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 93.86
3das_A 347 Putative oxidoreductase; aldose sugar dehydrogenas 93.76
1bpo_A494 Protein (clathrin); clathrin endocytosis beta-prop 92.04
3ott_A 758 Two-component system sensor histidine kinase; beta 91.95
2be1_A 339 Serine/threonine-protein kinase/endoribonuclease; 91.64
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 90.35
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 89.22
3sbq_A 638 Nitrous-oxide reductase; beta-propeller, cupredoxi 86.87
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 86.34
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 86.29
4gq2_M 950 Nucleoporin NUP120; beta propeller alpha helical, 85.09
3sbq_A 638 Nitrous-oxide reductase; beta-propeller, cupredoxi 83.57
4gq2_M 950 Nucleoporin NUP120; beta propeller alpha helical, 82.03
2wg3_C 463 Hedgehog-interacting protein; lipoprotein, develop 81.65
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
Probab=100.00  E-value=3.2e-44  Score=321.80  Aligned_cols=273  Identities=22%  Similarity=0.380  Sum_probs=236.5

Q ss_pred             eeeEEeCCeEehhhHHHHHHHcCCCccceEEEEEEeccCCCCCCcccCCCCcEEEEEec--CCEEEEEECCCeEEEEcC-
Q psy2107          67 QFDFLIAGELLRTSVTSFLESKGISSENVIDVEYLESTPTPSPLDCILHDDWVSAIDFH--NDWILTGCYDHSVHIWTR-  143 (391)
Q Consensus        67 ~~~f~~~~~~l~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~h~~~V~~~~~~--~~~l~t~~~dg~i~iwd~-  143 (391)
                      ...|.+++.++.+          .+.++.+.+|.......  ...+.+|.+.|++++|+  +++|++|+.||+|++||+ 
T Consensus       113 ~~~~~p~~~~l~s----------~s~Dg~i~vwd~~~~~~--~~~l~~h~~~V~~v~~~~~~~~l~sgs~D~~i~iwd~~  180 (410)
T 1vyh_C          113 RVIFHPVFSVMVS----------ASEDATIKVWDYETGDF--ERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLWDFQ  180 (410)
T ss_dssp             EEEECSSSSEEEE----------EESSSCEEEEETTTCCC--CEEECCCSSCEEEEEECTTSSEEEEEETTSCCCEEETT
T ss_pred             EEEEcCCCCEEEE----------EeCCCeEEEEECCCCcE--EEEEeccCCcEEEEEEcCCCCEEEEEeCCCeEEEEeCC
Confidence            3467777766654          34688999998654332  34566899999999998  679999999999999999 


Q ss_pred             CCceEEeccCCCCCeeEEEEEecCCCCeEEEEEeCCCcEEEEeecCCCCceeEEEEEecCCCCeEEEEEcCCCCEEEEEe
Q psy2107         144 RGEHKLNIPGHGGPVKGVAWLYNDGKDAAFISVSTDQTAMIWEWKVESNSIECIHVCRGHERGLETVTVSESRQQFATGG  223 (391)
Q Consensus       144 ~~~~~~~~~~~~~~v~~l~~~~~~~~~~~l~s~~~dg~v~iwd~~~~~~~~~~~~~~~~~~~~v~~l~~~~~~~~l~sg~  223 (391)
                      ....+..+.+|...|.+++|   ++++.+|++|+.|++|++||++    ...++..+.+|...|.+++++|++.+|++|+
T Consensus       181 ~~~~~~~~~~h~~~V~~v~~---~p~~~~l~s~s~D~~i~~wd~~----~~~~~~~~~~h~~~v~~~~~~~~g~~l~s~s  253 (410)
T 1vyh_C          181 GFECIRTMHGHDHNVSSVSI---MPNGDHIVSASRDKTIKMWEVQ----TGYCVKTFTGHREWVRMVRPNQDGTLIASCS  253 (410)
T ss_dssp             SSCEEECCCCCSSCEEEEEE---CSSSSEEEEEETTSEEEEEETT----TCCEEEEEECCSSCEEEEEECTTSSEEEEEE
T ss_pred             CCceeEEEcCCCCCEEEEEE---eCCCCEEEEEeCCCeEEEEECC----CCcEEEEEeCCCccEEEEEECCCCCEEEEEc
Confidence            45677788999999999999   7788999999999999999965    3457788899999999999999999999999


Q ss_pred             CCCcEEEEECCCCCCCCCCCCCCCCCccccccccccccCCCCCceeeecCccCcccEEEecc------------------
Q psy2107         224 WDCLLKIWSADISKERGDPSENGDEGTTSKKRKKEYSSASSRTPLITLKGHKEAISAVQWTA------------------  285 (391)
Q Consensus       224 ~dg~i~iwd~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~------------------  285 (391)
                      .||.|++||+++                             ......+.+|...|.+++|+|                  
T Consensus       254 ~D~~v~vwd~~~-----------------------------~~~~~~~~~h~~~v~~~~~~~~~~~~~~~~~~~~~~~~~  304 (410)
T 1vyh_C          254 NDQTVRVWVVAT-----------------------------KECKAELREHRHVVECISWAPESSYSSISEATGSETKKS  304 (410)
T ss_dssp             TTSCEEEEETTT-----------------------------CCEEEEECCCSSCEEEEEECCSCGGGGGGGCCSCC----
T ss_pred             CCCeEEEEECCC-----------------------------CceeeEecCCCceEEEEEEcCcccccchhhhcccccccc
Confidence            999999999976                             335667889999999999986                  


Q ss_pred             ---CCeEEEEECCCeEEEEecccCceeEEEECCe-eeEEEEECCCCCEEEEeeCCCcEEEEcCCCCCcceEEEEeccccC
Q psy2107         286 ---VDEIITSSWDHTLKIWDAELGGMKSEIVGNK-SFFDVHYSPLSKLVITASADKQIRLYDPKVKEGAIVKSTFSSHKE  361 (391)
Q Consensus       286 ---~~~l~s~~~dg~i~iwd~~~~~~~~~~~~~~-~i~~~~~~p~~~~l~~g~~dg~i~iwd~~~~~~~~~~~~~~~h~~  361 (391)
                         +..+++|+.|+.|++||++++.++..+.+|. .|.+++|+|++++|++|+.|+.|++||++..+   +...+.+|..
T Consensus       305 ~~~g~~l~sgs~D~~i~iwd~~~~~~~~~~~~h~~~v~~v~~~~~g~~l~s~s~D~~i~vwd~~~~~---~~~~~~~h~~  381 (410)
T 1vyh_C          305 GKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVWDYKNKR---CMKTLNAHEH  381 (410)
T ss_dssp             ---CCEEEEEETTSEEEEEETTTTEEEEEEECCSSCEEEEEECSSSSCEEEEETTTEEEEECCTTSC---CCEEEECCSS
T ss_pred             CCCCCEEEEEeCCCeEEEEECCCCceEEEEECCCCcEEEEEEcCCCCEEEEEeCCCeEEEEECCCCc---eEEEEcCCCC
Confidence               3469999999999999999999999998766 79999999999999999999999999998765   6678889999


Q ss_pred             cEEEEEECCCCCCEEEEeeCCCcEEEEecC
Q psy2107         362 WVQSVRWSPIDPQLFVSASFDNSVKLWDLR  391 (391)
Q Consensus       362 ~v~~~~~~~~~~~~l~s~~~dg~v~iwdlr  391 (391)
                      .|++++|+| ++.+|+||+.||+|++|++|
T Consensus       382 ~v~~l~~~~-~~~~l~sgs~D~~i~vW~~r  410 (410)
T 1vyh_C          382 FVTSLDFHK-TAPYVVTGSVDQTVKVWECR  410 (410)
T ss_dssp             CEEEEEECS-SSSCEEEEETTSEEEEEC--
T ss_pred             cEEEEEEcC-CCCEEEEEeCCCcEEEEeCC
Confidence            999999999 56679999999999999986



>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3qhy_B Beta-lactamase inhibitory protein II; enyzme-inhibitor complex, beta-propeller, protein:protein interaction; 2.06A {Streptomyces exfoliatus} PDB: 3qi0_A 1jtd_B Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 391
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 4e-24
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-14
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 8e-13
d1vyhc1 317 b.69.4.1 (C:92-408) Platelet-activating factor ace 7e-09
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 1e-21
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 1e-05
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 3e-19
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 4e-09
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 0.003
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 8e-18
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 2e-11
d1erja_ 388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 3e-06
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 3e-17
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 5e-11
d2ovrb2 342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 3e-05
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 8e-17
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 2e-10
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 9e-07
d1gxra_ 337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 0.003
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 9e-14
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 3e-05
d1nr0a2 299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 5e-05
d1nr0a2 299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 1e-04
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 1e-12
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 7e-07
d1pgua2 287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 2e-04
d1pgua2 287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 9e-04
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 1e-11
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 6e-09
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 6e-06
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 4e-05
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 1e-11
d1yfqa_ 342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 1e-05
d1yfqa_ 342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 7e-05
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 9e-04
d1yfqa_ 342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 0.001
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 8e-11
d1sq9a_ 393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 1e-07
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 1e-04
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 2e-04
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 3e-10
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 5e-10
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 0.002
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 1e-09
d1pgua1 325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 7e-04
d1qksa2 432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 5e-09
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 1e-08
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 3e-06
d1jmxb_ 346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 5e-05
d1jmxb_ 346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 9e-04
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 2e-08
d1nr0a1 311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 8e-04
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 6e-08
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 3e-04
d1hzua2 426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 5e-07
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 1e-04
d1pbyb_ 337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 4e-04
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 8e-04
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 0.001
d1ri6a_333 b.69.11.1 (A:) Putative isomerase YbhE {Escherichi 0.001
d1ri6a_ 333 b.69.11.1 (A:) Putative isomerase YbhE {Escherichi 0.001
d1l0qa2301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 0.001
d1l0qa2 301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 0.004
d1mdah_368 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 0.002
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Platelet-activating factor acetylhydrolase IB subunit alpha
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 99.0 bits (245), Expect = 4e-24
 Identities = 53/318 (16%), Positives = 116/318 (36%), Gaps = 59/318 (18%)

Query: 115 HDDWVSAIDFHND--WILTGCYDHSVHIW-TRRGEHKLNIPGHGGPVKGVA--------- 162
           H   V+ + FH     +++   D ++ +W    G+ +  + GH   V+ ++         
Sbjct: 16  HRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLLA 75

Query: 163 ------------------------------WLYNDGKDAAFISVSTDQTAMIWEWKVESN 192
                                          +         +S S D+T  +WE      
Sbjct: 76  SCSADMTIKLWDFQGFECIRTMHGHDHNVSSVSIMPNGDHIVSASRDKTIKMWEV----Q 131

Query: 193 SIECIHVCRGHERGLETVTVSESRQQFATGGWDCLLKIWSADISKERGDPSENGDEGTTS 252
           +  C+    GH   +  V  ++     A+   D  +++W     + + +  E+       
Sbjct: 132 TGYCVKTFTGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAELREHRHVVECI 191

Query: 253 KKRKKEYSSASSRTPLITLKGHKEAISAVQWTAVDEIITSSWDHTLKIWDAELGGMKSEI 312
               +   S+ S            + +         +++ S D T+K+WD   G     +
Sbjct: 192 SWAPESSYSSIS--------EATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTL 243

Query: 313 VGNKSF-FDVHYSPLSKLVITASADKQIRLYDPKVKEGAIVKSTFSSHKEWVQSVRWSPI 371
           VG+ ++   V +    K +++ + DK +R++D   K    +K T ++H+ +V S+ +   
Sbjct: 244 VGHDNWVRGVLFHSGGKFILSCADDKTLRVWD--YKNKRCMK-TLNAHEHFVTSLDFHK- 299

Query: 372 DPQLFVSASFDNSVKLWD 389
                V+ S D +VK+W+
Sbjct: 300 TAPYVVTGSVDQTVKVWE 317


>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Length = 333 Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Length = 333 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query391
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 100.0
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.98
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.97
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.97
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.96
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.96
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.96
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.96
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.95
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.95
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.94
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.9
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.89
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.87
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.85
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.82
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.82
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.79
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.79
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.79
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.77
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.76
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.7
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.68
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.67
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.64
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.56
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.49
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.39
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.29
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.25
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.23
d1qnia2 441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.13
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.07
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.07
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.04
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.03
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.98
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.97
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 98.93
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.81
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.8
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.77
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.66
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.59
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.57
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.46
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.42
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.2
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 98.15
d1xfda1 465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 97.89
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.88
d1xfda1 465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 97.87
d1fwxa2 459 Nitrous oxide reductase, N-terminal domain {Paraco 97.03
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 96.85
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 96.79
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 96.58
d1k32a2 281 Tricorn protease N-terminal domain {Archaeon Therm 96.55
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 96.17
d1v04a_ 340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 95.96
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 95.88
d1k3ia3 387 Galactose oxidase, central domain {Fungi (Fusarium 95.29
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 95.14
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 95.05
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 94.65
d1fwxa2 459 Nitrous oxide reductase, N-terminal domain {Paraco 94.49
d1xipa_ 381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 94.41
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 94.33
d2ad6a1 571 Methanol dehydrogenase, heavy chain {Methylophilus 94.31
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 94.1
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 93.47
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 91.63
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 91.59
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 91.57
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 91.04
d1qfma1 430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 90.82
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 90.39
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 87.66
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 85.57
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 84.55
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 84.06
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 82.07
d1jtdb_273 beta-lactamase inhibitor protein-II, BLIP-II {Stre 81.68
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Platelet-activating factor acetylhydrolase IB subunit alpha
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=100.00  E-value=1.9e-39  Score=277.78  Aligned_cols=246  Identities=22%  Similarity=0.443  Sum_probs=208.0

Q ss_pred             CCCCcccCCCCcEEEEEec--CCEEEEEECCCeEEEEcC-CCceEEeccCCCCCeeEEEEEec-----------------
Q psy2107         107 PSPLDCILHDDWVSAIDFH--NDWILTGCYDHSVHIWTR-RGEHKLNIPGHGGPVKGVAWLYN-----------------  166 (391)
Q Consensus       107 ~~~~~~~~h~~~V~~~~~~--~~~l~t~~~dg~i~iwd~-~~~~~~~~~~~~~~v~~l~~~~~-----------------  166 (391)
                      +....+.||.+.|++++|+  +++|+||+.||+|+|||+ +++.+..+.+|...|.+++|.|.                 
T Consensus         8 ~~~~~L~GH~~~I~~l~~sp~~~~l~s~s~Dg~i~iWd~~~~~~~~~~~~h~~~V~~~~~~~~~~~~~~~~~~~~~~~~~   87 (317)
T d1vyhc1           8 PEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLWD   87 (317)
T ss_dssp             SCSCEEECCSSCEEEEEECSSSSEEEEEESSSCEEEEETTTCCCCEEECCCSSCEEEEEECTTSSEEEEEETTSCCCEEE
T ss_pred             CccEEEcCCCCCeEEEEEcCCCCEEEEEeCCCeEEEEECCCCCEEEEEeCCCCcEEEEeeeccccccccccccccccccc
Confidence            3345678899999999998  679999999999999998 56667777788888888877443                 


Q ss_pred             ----------------------CCCCeEEEEEeCCCcEEEEeecCCCCceeEEEEEecCCCCeEEEEEcCCCCEEEEEeC
Q psy2107         167 ----------------------DGKDAAFISVSTDQTAMIWEWKVESNSIECIHVCRGHERGLETVTVSESRQQFATGGW  224 (391)
Q Consensus       167 ----------------------~~~~~~l~s~~~dg~v~iwd~~~~~~~~~~~~~~~~~~~~v~~l~~~~~~~~l~sg~~  224 (391)
                                            ++++..+++++.|+.+++||++    ....+..+.+|...+.+++|+|++++|++++.
T Consensus        88 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~----~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~  163 (317)
T d1vyhc1          88 FQGFECIRTMHGHDHNVSSVSIMPNGDHIVSASRDKTIKMWEVQ----TGYCVKTFTGHREWVRMVRPNQDGTLIASCSN  163 (317)
T ss_dssp             TTSSCEEECCCCCSSCEEEEEECSSSSEEEEEETTSEEEEEETT----TCCEEEEEECCSSCEEEEEECTTSSEEEEEET
T ss_pred             ccccccccccccccccceeeeccCCCceEEeeccCcceeEeecc----cceeeeEEccCCCcceeeecccCCCEEEEEeC
Confidence                                  3456678889999999999954    33567788899999999999999999999999


Q ss_pred             CCcEEEEECCCCCCCCCCCCCCCCCccccccccccccCCCCCceeeecCccCcccEEEecc-------------------
Q psy2107         225 DCLLKIWSADISKERGDPSENGDEGTTSKKRKKEYSSASSRTPLITLKGHKEAISAVQWTA-------------------  285 (391)
Q Consensus       225 dg~i~iwd~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~-------------------  285 (391)
                      |+.|++|+..+..                             ....+.+|...+.++.|++                   
T Consensus       164 d~~v~~~~~~~~~-----------------------------~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~  214 (317)
T d1vyhc1         164 DQTVRVWVVATKE-----------------------------CKAELREHRHVVECISWAPESSYSSISEATGSETKKSG  214 (317)
T ss_dssp             TSCEEEEETTTCC-----------------------------EEEEECCCSSCEEEEEECCSCGGGGGGGCCSCC-----
T ss_pred             CCeEEEEeeccce-----------------------------eeEEEecCCCCceEEEEeeccccceeeccccceeeeec
Confidence            9999999997633                             4445555666666665543                   


Q ss_pred             --CCeEEEEECCCeEEEEecccCceeEEEECCe-eeEEEEECCCCCEEEEeeCCCcEEEEcCCCCCcceEEEEeccccCc
Q psy2107         286 --VDEIITSSWDHTLKIWDAELGGMKSEIVGNK-SFFDVHYSPLSKLVITASADKQIRLYDPKVKEGAIVKSTFSSHKEW  362 (391)
Q Consensus       286 --~~~l~s~~~dg~i~iwd~~~~~~~~~~~~~~-~i~~~~~~p~~~~l~~g~~dg~i~iwd~~~~~~~~~~~~~~~h~~~  362 (391)
                        +..+++++.|+.|++||+++++++.++..+. .+.+++|+|++++|++|+.||.|++||+++++   ++..+.+|.+.
T Consensus       215 ~~~~~~~~~~~d~~i~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~l~s~~~dg~i~iwd~~~~~---~~~~~~~h~~~  291 (317)
T d1vyhc1         215 KPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVWDYKNKR---CMKTLNAHEHF  291 (317)
T ss_dssp             --CCEEEEEETTSEEEEEETTTTEEEEEEECCSSCEEEEEECSSSSCEEEEETTTEEEEECCTTSC---CCEEEECCSSC
T ss_pred             cCCceeEeccCCCEEEEEECCCCcEEEEEeCCCCCEEEEEECCCCCEEEEEECCCeEEEEECCCCc---EEEEEcCCCCC
Confidence              3458899999999999999999999998765 89999999999999999999999999998766   67788999999


Q ss_pred             EEEEEECCCCCCEEEEeeCCCcEEEEe
Q psy2107         363 VQSVRWSPIDPQLFVSASFDNSVKLWD  389 (391)
Q Consensus       363 v~~~~~~~~~~~~l~s~~~dg~v~iwd  389 (391)
                      |++++|+| ++.+|+||+.||+|+|||
T Consensus       292 V~~~~~s~-~~~~l~s~s~Dg~i~iWd  317 (317)
T d1vyhc1         292 VTSLDFHK-TAPYVVTGSVDQTVKVWE  317 (317)
T ss_dssp             EEEEEECS-SSSCEEEEETTSEEEEEC
T ss_pred             EEEEEEcC-CCCEEEEEeCCCeEEEeC
Confidence            99999999 556799999999999997



>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jtdb_ b.69.5.2 (B:) beta-lactamase inhibitor protein-II, BLIP-II {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure