Diaphorina citri psyllid: psy2110


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620--
SDLSIVASFDRRGQHVVTGNSKGKVLVLSCPALELKASRGNCLLVNTGDRLIRVYNHQEVLNAGKDGDPEPIQKLQDLVNKTMWKKCCFSGDGEYVCAGSARQHALYIWEKSVGNLVKILHGTKGELLLDVVEFDGALDCISLAVTCAFNKRGTLLAVGCNDGRIVLWDFLTRGIAKIISAHMHPEFDGALDCISLAVTCAFNKRGTLLAVGCNDGRIVLWDFLTRGIAKIISAHMHPVCSISWSRNGYKIISASTDNNVCIWDVLTGECEQKYRFPSPILKVQFHPRNDHMFLVCPMRHAAVLVDTDGDHQIVPIDEDSDLSIVASFDRRGQHVVTGNSKGKVLVLSCPALELKASFKASTTAIKSIEFARRGNCLLVNTGDRLIRVYNHQEVLNAGKDGDPEPIQKLQDLVNKTMWKKCCFSGDGEYVCAGSARQHALYIWEKSVGNLVKILHGTKGELLLDVVWHPVRPIIASISSGVVSLWAQNQVENWSAFAPDFKELDENVEYDERESEFDISDEDKSVAQGSDDQDEELEIDVTSVEPVAAFCSSDEEVDDSKVLEFLPIAPDVEDPEDGPGSTSAPVTSSPPSKTTKYKSFDIQLEGAACQGIGIILPTGVNLE
cccEEEEEEcccccEEEEEcccccEEEEEcccccEEcccccEEEEEccccEEEEEEcccccccccccccccEEEEEcccccccEEEEEEcccccEEEEECccccEEEEEEcccccEEEEEEcccccEEEEEEEccccccccccEEEEEEcccccEEEEEcccccEEEEEcccccEEEEEcccccccccccccccccEEEEEEcccccEEEEEEccccEEEEEccccEEEcccccccccEEEEEEcccccEEEEECccccEEEEEcccccEEEEECccccEEEEEEECccccEEEEEccccEEEEEEccccCEEEEcccccccEEEEEEcccccEEEEEcccccEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEEccccEEEEEcccccccccccccccCEEEEcccccccEEEEEEcccccEEEEECccccEEEEEEccccEEEEEEcccccccEEEEEEcccccEEEEEccccEEEccccccccEEccccccccCEccccccccCEEEEEcccccEEEEccccccCEEEEccccccCEEccccccccccccEEEEECcccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccc
SDLSIVASFDRRGQHVVTGNSKGKVLVLSCPALELKASRGNCLLVNTGDRLIRVYNHQEVLNAGKDGDPEPIQKLQDLVNKTMWKKCCFSGDGEYVCAGSARQHALYIWEKSVGNLVKILHGTKGELLLDVVEFDGALDCISLAVTCAFNKRGTLLAVGCNDGRIVLWDFLTRGIAKIISAHMHPEFDGALDCISLAVTCAFNKRGTLLAVGCNDGRIVLWDFLTRGIAKIISAHMHPVCSISWSRNGYKIISASTDNNVCIWDVLTGECEQKYRFPSPILKVQFHPRNDHMFLVCPMRHAAVLVDTDGDHQIVPIDEDSDLSIVASFDRRGQHVVTGNSKGKVLVLSCPALELKASFKASTTAIKSIEFARRGNCLLVNTGDRLIRVYNHQEVLNAGKDGDPEPIQKLQDLVNKTMWKKCCFSGDGEYVCAGSARQHALYIWEKSVGNLVKILHGTKGELLLDVVWHPVRPIIASISSGVVSLWAQNQVENWSAFAPDFKELDENVEYDERESEFDISDEDKSVAQGSDDQDEELEIDVTSVEPVAAFCSSDEEVDDSKVLEFLPIA********************************IQLEGAACQGIGI*********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SDLSIVASFDRRGQHVVTGNSKGKVLVLSCPALELKASRGNCLLVNTGDRLIRVYNHQEVLNAGKDGDPEPIQKLQDLVNKTMWKKCCFSGDGEYVCAGSARQHALYIWEKSVGNLVKILHGTKGELLLDVVEFDGALDCISLAVTCAFNKRGTLLAVGCNDGRIVLWDFLTRGIAKIISAHMHPEFDGALDCISLAVTCAFNKRGTLLAVGCNDGRIVLWDFLTRGIAKIISAHMHPVCSISWSRNGYKIISASTDNNVCIWDVLTGECEQKYRFPSPILKVQFHPRNDHMFLVCPMRHAAVLVDTDGDHQIVPIDEDSDLSIVASFDRRGQHVVTGNSKGKVLVLSCPALELKASFKASTTAIKSIEFARRGNCLLVNTGDRLIRVYNHQEVLNAGKDGDPEPIQKLQDLVNKTMWKKCCFSGDGEYVCAGSARQHALYIWEKSVGNLVKILHGTKGELLLDVVWHPVRPIIASISSGVVSLWAQNQVENWSAFAPDFKELDENVEYDERESEFDISDEDKSVAQGSDDQDEELEIDVTSVEPVAAFCSSDEEVDDSKVLEFLPIAPDVEDPEDGPGSTSAPVTSSPPSKTTKYKSFDIQLEGAACQGIGIILPTGVNLE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Retinoblastoma-binding protein 5 As part of the MLL1/MLL complex it is involved in methylation and dimethylation at 'Lys-4' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation.very confidentQ15291
Retinoblastoma-binding protein 5 As part of the MLL1/MLL complex it is involved in methylation and dimethylation at 'Lys-4' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation.confidentQ8BX09
Uncharacterized WD repeat-containing protein F21H12.1 confidentQ09309

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006974 [BP]response to DNA damage stimulusconfidentGO:0051716, GO:0050896, GO:0009987, GO:0006950, GO:0044763, GO:0033554, GO:0008150, GO:0044699
GO:0071339 [CC]MLL1 complexconfidentGO:0031974, GO:0043229, GO:0005623, GO:0043227, GO:0043226, GO:0034708, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0035097, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044422, GO:0044665
GO:0043627 [BP]response to estrogen stimulusconfidentGO:0009719, GO:0033993, GO:0050896, GO:0008150, GO:0048545, GO:0009725, GO:0042221, GO:0010033, GO:0014070
GO:0048188 [CC]Set1C/COMPASS complexconfidentGO:0031974, GO:0043229, GO:0005623, GO:0043227, GO:0043226, GO:0034708, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0035097, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0042800 [MF]histone methyltransferase activity (H3-K4 specific)confidentGO:0018024, GO:0042054, GO:0003824, GO:0008757, GO:0016740, GO:0016278, GO:0016279, GO:0016741, GO:0008170, GO:0008276, GO:0003674, GO:0008168
GO:0035064 [MF]methylated histone residue bindingconfidentGO:0042393, GO:0003674, GO:0005488, GO:0005515
GO:0051568 [BP]histone H3-K4 methylationconfidentGO:0006479, GO:0008213, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0016043, GO:0071704, GO:0034968, GO:0016571, GO:0016570, GO:0032259, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0043414, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0019538, GO:0044763, GO:0044237, GO:0043170, GO:0008150, GO:0016568, GO:0016569
GO:0044212 [MF]transcription regulatory region DNA bindingconfidentGO:0097159, GO:0000975, GO:0001067, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0044666 [CC]MLL3/4 complexconfidentGO:0031974, GO:0043229, GO:0005623, GO:0043227, GO:0043226, GO:0034708, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0035097, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0006355 [BP]regulation of transcription, DNA-dependentprobableGO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0006351 [BP]transcription, DNA-dependentprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0019438
GO:0046427 [BP]positive regulation of JAK-STAT cascadeprobableGO:0023051, GO:0046425, GO:0009966, GO:0010740, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0009967, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0010627, GO:0050789, GO:0048522

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YMU, chain A
Confidence level:very confident
Coverage over the Query: 1-127,145-183,195-393,404-486
View the alignment between query and template
View the model in PyMOL
Template: 2YMU, chain A
Confidence level:very confident
Coverage over the Query: 1-127,145-183,195-393,404-505
View the alignment between query and template
View the model in PyMOL
Template: 1ERJ, chain A
Confidence level:very confident
Coverage over the Query: 145-181,192-288,331-391,404-488
View the alignment between query and template
View the model in PyMOL
Template: 2OAJ, chain A
Confidence level:confident
Coverage over the Query: 2-491
View the alignment between query and template
View the model in PyMOL