Diaphorina citri psyllid: psy2111

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60---
MGEVGWEKKRRAYRTLHGAWFNSKLVTVKYLRYERYHERFPQAKALVAPLKPSNDRRYSLQQA
cccccHHHHHHHHHHHHcccccccEEEEEEEcHHHHHHHcccccccccccccccccccccccc
*******KKRRAYRTLHGAWFNSKLVTVKYLRYERYHERFPQAKALV****************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGEVGWEKKRRAYRTLHGAWFNSKLVTVKYLRYERYHERFPQAKALVAPLKPSNDRRYSLQQA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Inner nuclear membrane protein Man1 Can function as a specific repressor of TGF-beta, activin, and BMP signaling through its interaction with the R-SMAD proteins. Antagonizes TGF-beta-induced cell proliferation arrest.confidentQ9WU40
Inner nuclear membrane protein Man1 Can function as a specific repressor of TGF-beta, activin, and BMP signaling through its interaction with the R-SMAD proteins. Antagonizes TGF-beta-induced cell proliferation arrest.confidentQ9Y2U8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0032926 [BP]negative regulation of activin receptor signaling pathwayprobableGO:0090092, GO:0032925, GO:0009968, GO:0090101, GO:0009966, GO:0048585, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0023051, GO:0048519, GO:0010646, GO:0050789, GO:0048523
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0030514 [BP]negative regulation of BMP signaling pathwayprobableGO:0090092, GO:0009968, GO:0090101, GO:0009966, GO:0048585, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0023051, GO:0048519, GO:0010646, GO:0050789, GO:0048523, GO:0030510
GO:0030512 [BP]negative regulation of transforming growth factor beta receptor signaling pathwayprobableGO:0090287, GO:0009968, GO:0090101, GO:0009966, GO:0048583, GO:0048585, GO:0017015, GO:0090288, GO:0050794, GO:0090092, GO:0023057, GO:0065007, GO:0010648, GO:0008150, GO:0023051, GO:0048519, GO:0010646, GO:0050789, GO:0048523
GO:0005637 [CC]nuclear inner membraneprobableGO:0005575, GO:0016020, GO:0031090, GO:0005623, GO:0031965, GO:0005634, GO:0005635, GO:0019866, GO:0031967, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0044464, GO:0031975, GO:0043227, GO:0043226, GO:0044422, GO:0043231

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3S6E, chain A
Confidence level:very confident
Coverage over the Query: 2-55
View the alignment between query and template
View the model in PyMOL