Diaphorina citri psyllid: psy2115


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70-------
MEINTNPKKLRGHKFNWTNPEDIRNNETKPNFVEMGPYRFHYGDKYKSQKTSGPQKWSGGPHVARRPLVGNPWSRVV
ccccccccEEEEEEECcccHHHccccccccccEECccEEEECccCEEECccccccccccccCEECcccccccccccc
****TNPKKLRGHKFNWTNPEDIRNNETKPNFVEMGPYRFHYGDKY***************HVARRPLVGNPWSRV*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEINTNPKKLRGHKFNWTNPEDIRNNETKPNFVEMGPYRFHYGDKYKSQKTSGPQKWSGGPHVARRPLVGNPWSRVV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0002433 [BP]immune response-regulating cell surface receptor signaling pathway involved in phagocytosisprobableGO:0006897, GO:0016192, GO:0006810, GO:0002376, GO:0044765, GO:0008150, GO:0002252, GO:0006909, GO:0051234, GO:0051179, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

No confident structure templates for the query are predicted