Diaphorina citri psyllid: psy2116


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100--
MYACSRKPRPWSLINWFYFALVLFSQEAELKTLPNTRGTKYLQMGKYEMEVWYQSPYPDDYARLPKLYLCEFCLKYMKTKTILFRHANKCVWKHPPGEEVYR
cccccccccccccHHHHHHHHHHHHHHHHHccccccccccEEEEccEEEEEcccccccccccccccccEEHHHHcccccHHHHHHHHHcccccccccccccc
*********PWSLINWFYFALVLFSQEAELKTLPNTRGTKYLQMGKYEMEVWYQSPYPDDYARLPKLYLCEFCLKYMKTKTILFRHANKCVWKHPPGEEVYR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYACSRKPRPWSLINWFYFALVLFSQEAELKTLPNTRGTKYLQMGKYEMEVWYQSPYPDDYARLPKLYLCEFCLKYMKTKTILFRHANKCVWKHPPGEEVYR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Putative MYST-like histone acetyltransferase 1 Histone acetyltransferase which may be involved in transcriptional activation.confidentQ8LI34
Histone acetyltransferase KAT6A Histone acetyltransferase that acetylates lysine residues in histone H3 and histone H4 (in vitro). Component of the MOZ/MORF complex which has a histone H3 acetyltransferase activity. May act as a transcriptional coactivator for RUNX1 and RUNX2.confidentQ5TKR9
Histone acetyltransferase ESA1 Catalytic component of the NuA4 histone acetyltransferase (HAT) complex which is involved in epigenetic transcriptional activation of selected genes principally by acetylation of nucleosomal histones H4, H3, H2B, H2A and H2A variant H2A.Z. Acetylates histone H4 to form H4K5ac, H4K8ac, H4K12ac and H4K16ac, histone H3 to form H3K14ac, and histone H2A to form H2AK4ac and H2AK7ac. Acetylation of histone H4 is essential for DNA double-strand break repair through homologous recombination. Involved in cell cycle progression. Recruitment to promoters depends on H3K4me.confidentP0CP02

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043966 [BP]histone H3 acetylationprobableGO:0043543, GO:0006473, GO:0006475, GO:0016043, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0018193, GO:0071704, GO:0016570, GO:0016573, GO:0018393, GO:0018394, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0044763, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0018205, GO:0044237, GO:0043170, GO:0019538, GO:0008150, GO:0016568, GO:0016569
GO:0016605 [CC]PML bodyprobableGO:0044446, GO:0016604, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422
GO:0000904 [BP]cell morphogenesis involved in differentiationprobableGO:0032502, GO:0048856, GO:0000902, GO:0048869, GO:0030154, GO:0048468, GO:0016043, GO:0032989, GO:0044767, GO:0044763, GO:0071840, GO:0008150, GO:0009987, GO:0009653, GO:0044699
GO:0006974 [BP]response to DNA damage stimulusprobableGO:0051716, GO:0050896, GO:0009987, GO:0006950, GO:0044763, GO:0033554, GO:0008150, GO:0044699
GO:0043981 [BP]histone H4-K5 acetylationprobableGO:0043543, GO:0006473, GO:0006475, GO:0016043, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0018394, GO:0018193, GO:0071704, GO:0016570, GO:0016573, GO:0018393, GO:0043967, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0018205, GO:0044237, GO:0043170, GO:0019538, GO:0044763, GO:0016568, GO:0016569
GO:0000790 [CC]nuclear chromatinprobableGO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0043982 [BP]histone H4-K8 acetylationprobableGO:0043543, GO:0006473, GO:0006475, GO:0016043, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0018394, GO:0018193, GO:0071704, GO:0016570, GO:0016573, GO:0018393, GO:0043967, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0018205, GO:0044237, GO:0043170, GO:0019538, GO:0044763, GO:0016568, GO:0016569
GO:0043983 [BP]histone H4-K12 acetylationprobableGO:0043543, GO:0006473, GO:0006475, GO:0016043, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0018394, GO:0018193, GO:0071704, GO:0016570, GO:0016573, GO:0018393, GO:0043967, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0018205, GO:0044237, GO:0043170, GO:0019538, GO:0044763, GO:0016568, GO:0016569
GO:0043984 [BP]histone H4-K16 acetylationprobableGO:0043543, GO:0006473, GO:0006475, GO:0016043, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0018394, GO:0018193, GO:0071704, GO:0016570, GO:0016573, GO:0018393, GO:0043967, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0018205, GO:0044237, GO:0043170, GO:0019538, GO:0044763, GO:0016568, GO:0016569
GO:0008134 [MF]transcription factor bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0003677 [MF]DNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0010485 [MF]H4 histone acetyltransferase activityprobableGO:0008080, GO:0004402, GO:0016740, GO:0003824, GO:0016407, GO:0016746, GO:0016747, GO:0016410, GO:0003674
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0003713 [MF]transcription coactivator activityprobableGO:0003674, GO:0003712, GO:0000989, GO:0000988
GO:0006260 [BP]DNA replicationprobableGO:0071704, GO:1901576, GO:0044238, GO:0008152, GO:0044260, GO:0006139, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0043170, GO:0090304, GO:0044249, GO:0009058, GO:0009059, GO:0006807, GO:0034645, GO:0006259, GO:0008150, GO:1901360, GO:0046483
GO:0035267 [CC]NuA4 histone acetyltransferase complexprobableGO:0031974, GO:0043229, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0043189, GO:0005654, GO:0044451, GO:0043231, GO:0043234, GO:0032991, GO:0000123, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0045892 [BP]negative regulation of transcription, DNA-dependentprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0010558, GO:0048523
GO:0070776 [CC]MOZ/MORF histone acetyltransferase complexprobableGO:0031974, GO:0043229, GO:0005623, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0043231, GO:0043234, GO:0032991, GO:0000123, GO:0043233, GO:0044464, GO:0070775, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0030099 [BP]myeloid cell differentiationprobableGO:0032502, GO:0002376, GO:0009987, GO:0044707, GO:0048856, GO:0048869, GO:0032501, GO:0030154, GO:0044767, GO:0048513, GO:0044763, GO:0008150, GO:0048731, GO:0030097, GO:0048534, GO:0007275, GO:0044699, GO:0002520
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488
GO:0090398 [BP]cellular senescenceprobableGO:0032502, GO:0051716, GO:0007568, GO:0007569, GO:0050896, GO:0009987, GO:0044767, GO:0006950, GO:0044763, GO:0033554, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2OZU, chain A
Confidence level:very confident
Coverage over the Query: 37-102
View the alignment between query and template
View the model in PyMOL