Psyllid ID: psy2116
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 102 | ||||||
| 270013354 | 823 | hypothetical protein TcasGA2_TC011945 [T | 0.872 | 0.108 | 0.681 | 1e-31 | |
| 189241087 | 793 | PREDICTED: similar to chameau CG5229-PA | 0.872 | 0.112 | 0.681 | 1e-31 | |
| 328719200 | 671 | PREDICTED: hypothetical protein LOC10016 | 0.872 | 0.132 | 0.681 | 3e-31 | |
| 242024233 | 907 | peptidyl-prolyl cis-trans isomerase G, p | 0.872 | 0.098 | 0.670 | 6e-31 | |
| 195117336 | 824 | GI23751 [Drosophila mojavensis] gi|19391 | 0.872 | 0.108 | 0.615 | 3e-28 | |
| 195052432 | 851 | GH13734 [Drosophila grimshawi] gi|193900 | 0.745 | 0.089 | 0.684 | 1e-27 | |
| 386769280 | 703 | chameau, isoform B [Drosophila melanogas | 0.745 | 0.108 | 0.684 | 1e-27 | |
| 194862852 | 811 | GG10479 [Drosophila erecta] gi|190662022 | 0.745 | 0.093 | 0.684 | 1e-27 | |
| 195387760 | 829 | GJ20948 [Drosophila virilis] gi|19414901 | 0.745 | 0.091 | 0.684 | 1e-27 | |
| 300244594 | 722 | MIP19344p [Drosophila melanogaster] | 0.745 | 0.105 | 0.684 | 2e-27 |
| >gi|270013354|gb|EFA09802.1| hypothetical protein TcasGA2_TC011945 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Score = 140 bits (353), Expect = 1e-31, Method: Compositional matrix adjust.
Identities = 62/91 (68%), Positives = 76/91 (83%), Gaps = 2/91 (2%)
Query: 14 INWFYFALVLFSQ--EAELKTLPNTRGTKYLQMGKYEMEVWYQSPYPDDYARLPKLYLCE 71
+ F A L S+ E +LKT PNT+GTK ++MGK+EMEVWYQSPYP+DYARLPKLY+CE
Sbjct: 482 LKLFRDAQALASEKIEEDLKTQPNTKGTKCIEMGKFEMEVWYQSPYPEDYARLPKLYICE 541
Query: 72 FCLKYMKTKTILFRHANKCVWKHPPGEEVYR 102
+CL+YMKT+T+L RH KCVW+HPPGEEVYR
Sbjct: 542 YCLRYMKTRTVLQRHVVKCVWRHPPGEEVYR 572
|
Source: Tribolium castaneum Species: Tribolium castaneum Genus: Tribolium Family: Tenebrionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|189241087|ref|XP_970403.2| PREDICTED: similar to chameau CG5229-PA [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|328719200|ref|XP_001945908.2| PREDICTED: hypothetical protein LOC100160130 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|242024233|ref|XP_002432533.1| peptidyl-prolyl cis-trans isomerase G, putative [Pediculus humanus corporis] gi|212517985|gb|EEB19795.1| peptidyl-prolyl cis-trans isomerase G, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|195117336|ref|XP_002003203.1| GI23751 [Drosophila mojavensis] gi|193913778|gb|EDW12645.1| GI23751 [Drosophila mojavensis] | Back alignment and taxonomy information |
|---|
| >gi|195052432|ref|XP_001993300.1| GH13734 [Drosophila grimshawi] gi|193900359|gb|EDV99225.1| GH13734 [Drosophila grimshawi] | Back alignment and taxonomy information |
|---|
| >gi|386769280|ref|NP_001245930.1| chameau, isoform B [Drosophila melanogaster] gi|383291382|gb|AFH03604.1| chameau, isoform B [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|194862852|ref|XP_001970155.1| GG10479 [Drosophila erecta] gi|190662022|gb|EDV59214.1| GG10479 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
| >gi|195387760|ref|XP_002052560.1| GJ20948 [Drosophila virilis] gi|194149017|gb|EDW64715.1| GJ20948 [Drosophila virilis] | Back alignment and taxonomy information |
|---|
| >gi|300244594|gb|ADJ93830.1| MIP19344p [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 102 | ||||||
| FB|FBgn0028387 | 811 | chm "chameau" [Drosophila mela | 0.745 | 0.093 | 0.684 | 1.7e-27 | |
| ZFIN|ZDB-GENE-060929-168 | 606 | zgc:154037 "zgc:154037" [Danio | 0.617 | 0.103 | 0.666 | 2.8e-23 | |
| UNIPROTKB|E7EUP3 | 425 | KAT7 "Histone acetyltransferas | 0.617 | 0.148 | 0.666 | 4.1e-23 | |
| UNIPROTKB|G3V125 | 455 | KAT7 "MYST histone acetyltrans | 0.617 | 0.138 | 0.666 | 6.2e-23 | |
| UNIPROTKB|D4A4Q5 | 522 | Myst2 "Protein Myst2" [Rattus | 0.617 | 0.120 | 0.666 | 1.1e-22 | |
| ZFIN|ZDB-GENE-030131-1901 | 568 | kat7 "K(lysine) acetyltransfer | 0.617 | 0.110 | 0.698 | 1.1e-22 | |
| UNIPROTKB|F1NGX4 | 606 | MYST2 "Uncharacterized protein | 0.617 | 0.103 | 0.666 | 1.7e-22 | |
| UNIPROTKB|Q08DP5 | 611 | MYST2 "Uncharacterized protein | 0.617 | 0.103 | 0.666 | 1.7e-22 | |
| UNIPROTKB|O95251 | 611 | KAT7 "Histone acetyltransferas | 0.617 | 0.103 | 0.666 | 1.7e-22 | |
| UNIPROTKB|F1RTB9 | 611 | MYST2 "Uncharacterized protein | 0.617 | 0.103 | 0.666 | 1.7e-22 |
| FB|FBgn0028387 chm "chameau" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 318 (117.0 bits), Expect = 1.7e-27, P = 1.7e-27
Identities = 52/76 (68%), Positives = 65/76 (85%)
Query: 27 EAELKTLPNTRGTKYLQMGKYEMEVWYQSPYPDDYARLPKLYLCEFCLKYMKTKTILFRH 86
E ELK LP +G KY+ MGKY+M+VWYQSPYPDD ARLPK+Y+CEFCL+Y K++T + RH
Sbjct: 516 EDELKDLPVGKGIKYISMGKYKMKVWYQSPYPDDAARLPKMYICEFCLRYQKSETGIKRH 575
Query: 87 ANKCVWKHPPGEEVYR 102
A KCVW+HPPG+E+YR
Sbjct: 576 AEKCVWRHPPGDEIYR 591
|
|
| ZFIN|ZDB-GENE-060929-168 zgc:154037 "zgc:154037" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E7EUP3 KAT7 "Histone acetyltransferase KAT7" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3V125 KAT7 "MYST histone acetyltransferase 2, isoform CRA_d" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D4A4Q5 Myst2 "Protein Myst2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-1901 kat7 "K(lysine) acetyltransferase 7" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NGX4 MYST2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q08DP5 MYST2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O95251 KAT7 "Histone acetyltransferase KAT7" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RTB9 MYST2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 102 | |||
| PLN00104 | 450 | PLN00104, PLN00104, MYST -like histone acetyltrans | 4e-26 | |
| PLN03238 | 290 | PLN03238, PLN03238, probable histone acetyltransfe | 2e-23 | |
| COG5027 | 395 | COG5027, SAS2, Histone acetyltransferase (MYST fam | 5e-19 | |
| PTZ00064 | 552 | PTZ00064, PTZ00064, histone acetyltransferase; Pro | 7e-18 | |
| PLN03239 | 351 | PLN03239, PLN03239, histone acetyltransferase; Pro | 4e-09 |
| >gnl|CDD|215056 PLN00104, PLN00104, MYST -like histone acetyltransferase; Provisional | Back alignment and domain information |
|---|
Score = 99.4 bits (248), Expect = 4e-26
Identities = 34/61 (55%), Positives = 45/61 (73%)
Query: 42 LQMGKYEMEVWYQSPYPDDYARLPKLYLCEFCLKYMKTKTILFRHANKCVWKHPPGEEVY 101
+++G+YE++ WY SP+P +Y KLY CEFCLK+MK K L RH KC KHPPG+E+Y
Sbjct: 173 IELGRYEIDTWYFSPFPPEYNDCSKLYFCEFCLKFMKRKEQLQRHMKKCDLKHPPGDEIY 232
Query: 102 R 102
R
Sbjct: 233 R 233
|
Length = 450 |
| >gnl|CDD|215642 PLN03238, PLN03238, probable histone acetyltransferase MYST; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227360 COG5027, SAS2, Histone acetyltransferase (MYST family) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|173359 PTZ00064, PTZ00064, histone acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178777 PLN03239, PLN03239, histone acetyltransferase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 102 | |||
| PLN03238 | 290 | probable histone acetyltransferase MYST; Provision | 100.0 | |
| KOG2747|consensus | 396 | 99.97 | ||
| PLN00104 | 450 | MYST -like histone acetyltransferase; Provisional | 99.97 | |
| PTZ00064 | 552 | histone acetyltransferase; Provisional | 99.97 | |
| PLN03239 | 351 | histone acetyltransferase; Provisional | 99.97 | |
| COG5027 | 395 | SAS2 Histone acetyltransferase (MYST family) [Chro | 99.92 | |
| PF00096 | 23 | zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 | 96.86 | |
| PF13894 | 24 | zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP | 96.34 | |
| PF13912 | 27 | zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 | 95.28 | |
| PF12171 | 27 | zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi | 93.84 | |
| PHA02768 | 55 | hypothetical protein; Provisional | 93.57 | |
| PF12874 | 25 | zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG | 93.17 | |
| smart00355 | 26 | ZnF_C2H2 zinc finger. | 92.13 | |
| PF13913 | 25 | zf-C2HC_2: zinc-finger of a C2HC-type | 91.97 | |
| smart00451 | 35 | ZnF_U1 U1-like zinc finger. Family of C2H2-type zi | 89.86 | |
| PF13909 | 24 | zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W | 88.3 | |
| PHA00616 | 44 | hypothetical protein | 84.77 |
| >PLN03238 probable histone acetyltransferase MYST; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.4e-34 Score=228.62 Aligned_cols=79 Identities=44% Similarity=0.966 Sum_probs=76.9
Q ss_pred cChHHhhhcCCCCCCCCEEEecCeEEeeccCCCCccccCCCCceeeehhhhcccCCHHHHHHHHhhCCCCCCCCccccC
Q psy2116 24 FSQEAELKTLPNTRGTKYLQMGKYEMEVWYQSPYPDDYARLPKLYLCEFCLKYMKTKTILFRHANKCVWKHPPGEEVYR 102 (102)
Q Consensus 24 ~~~e~e~~~~~~~kNI~~V~fG~y~i~tWY~SPYP~e~~~~~~LYICE~ClkY~~s~~~l~rH~~kC~~r~PPG~eIYR 102 (102)
..+++||++++++|||++|+||+|+|+|||+||||+++.+.++||||||||+||+++.+|.+|+.+|+++||||+||||
T Consensus 5 ~~~~~~~ee~t~~kni~~i~~G~y~i~~WY~SPyP~e~~~~~~lyiCe~Clky~~~~~~l~~H~~~C~~r~PPG~eIYr 83 (290)
T PLN03238 5 AELEREHEETTKVKNIEMIELGKYEMDTWYYSPYPEPYASCTKLYICEYCLKYMRKKKSLLRHLAKCDIRQPPGGGIYG 83 (290)
T ss_pred hHHHhcchhhhcCCCcCEEEECCeeeecCccCCCChHHcCCCeEEEcCCCcchhCCHHHHHHHHHhCCCCCCCcCEeEe
Confidence 4578999999999999999999999999999999999999999999999999999999999999999999999999997
|
|
| >KOG2747|consensus | Back alignment and domain information |
|---|
| >PLN00104 MYST -like histone acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PTZ00064 histone acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN03239 histone acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG5027 SAS2 Histone acetyltransferase (MYST family) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A | Back alignment and domain information |
|---|
| >PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B | Back alignment and domain information |
|---|
| >PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length | Back alignment and domain information |
|---|
| >PHA02768 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A | Back alignment and domain information |
|---|
| >smart00355 ZnF_C2H2 zinc finger | Back alignment and domain information |
|---|
| >PF13913 zf-C2HC_2: zinc-finger of a C2HC-type | Back alignment and domain information |
|---|
| >smart00451 ZnF_U1 U1-like zinc finger | Back alignment and domain information |
|---|
| >PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A | Back alignment and domain information |
|---|
| >PHA00616 hypothetical protein | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 102 | ||||
| 2rc4_A | 287 | Crystal Structure Of The Hat Domain Of The Human Mo | 8e-22 | ||
| 2ozu_A | 284 | Crystal Structure Of Human Myst Histone Acetyltrans | 8e-22 | ||
| 2y0m_A | 287 | Crystal Structure Of The Complex Between Dosage Com | 1e-15 | ||
| 3qah_A | 304 | Crystal Structure Of Apo-Form Human Mof Catalytic D | 1e-15 | ||
| 3toa_A | 266 | Human Mof Crystal Structure With Active Site Lysine | 1e-15 | ||
| 2pq8_A | 278 | Myst Histone Acetyltransferase 1 Length = 278 | 1e-15 | ||
| 2giv_A | 295 | Human Myst Histone Acetyltransferase 1 Length = 295 | 1e-15 | ||
| 3tob_A | 270 | Human Mof E350q Crystal Structure With Active Site | 1e-15 | ||
| 4dnc_A | 289 | Crystal Structure Of Human Mof In Complex With Msl1 | 1e-15 | ||
| 2ou2_A | 280 | Acetyltransferase Domain Of Human Hiv-1 Tat Interac | 1e-14 | ||
| 1mja_A | 278 | Crystal Structure Of Yeast Esa1 Histone Acetyltrans | 5e-11 | ||
| 1mjb_A | 278 | Crystal Structure Of Yeast Esa1 Histone Acetyltrans | 5e-11 | ||
| 1mj9_A | 278 | Crystal Structure Of Yeast Esa1(C304s) Mutant Compl | 5e-11 | ||
| 1fy7_A | 278 | Crystal Structure Of Yeast Esa1 Histone Acetyltrans | 6e-11 | ||
| 3to9_A | 276 | Crystal Structure Of Yeast Esa1 E338q Hat Domain Bo | 2e-10 | ||
| 3to6_A | 276 | Crystal Structure Of Yeast Esa1 Hat Domain Complexe | 2e-10 | ||
| 1m36_A | 33 | Solution Structure Of A Cchc Zinc Finger From Moz L | 6e-08 |
| >pdb|2RC4|A Chain A, Crystal Structure Of The Hat Domain Of The Human Moz Protein Length = 287 | Back alignment and structure |
|
| >pdb|2OZU|A Chain A, Crystal Structure Of Human Myst Histone Acetyltransferase 3 In Complex With Acetylcoenzyme A Length = 284 | Back alignment and structure |
| >pdb|2Y0M|A Chain A, Crystal Structure Of The Complex Between Dosage Compensation Factors Msl1 And Mof Length = 287 | Back alignment and structure |
| >pdb|3QAH|A Chain A, Crystal Structure Of Apo-Form Human Mof Catalytic Domain Length = 304 | Back alignment and structure |
| >pdb|2PQ8|A Chain A, Myst Histone Acetyltransferase 1 Length = 278 | Back alignment and structure |
| >pdb|2GIV|A Chain A, Human Myst Histone Acetyltransferase 1 Length = 295 | Back alignment and structure |
| >pdb|4DNC|A Chain A, Crystal Structure Of Human Mof In Complex With Msl1 Length = 289 | Back alignment and structure |
| >pdb|2OU2|A Chain A, Acetyltransferase Domain Of Human Hiv-1 Tat Interacting Protein, 60kda, Isoform 3 Length = 280 | Back alignment and structure |
| >pdb|1MJA|A Chain A, Crystal Structure Of Yeast Esa1 Histone Acetyltransferase Domain Complexed With Acetyl Coenzyme A Length = 278 | Back alignment and structure |
| >pdb|1MJB|A Chain A, Crystal Structure Of Yeast Esa1 Histone Acetyltransferase E338q Mutant Complexed With Acetyl Coenzyme A Length = 278 | Back alignment and structure |
| >pdb|1MJ9|A Chain A, Crystal Structure Of Yeast Esa1(C304s) Mutant Complexed With Coenzyme A Length = 278 | Back alignment and structure |
| >pdb|1FY7|A Chain A, Crystal Structure Of Yeast Esa1 Histone Acetyltransferase Domain Complexed With Coenzyme A Length = 278 | Back alignment and structure |
| >pdb|3TO9|A Chain A, Crystal Structure Of Yeast Esa1 E338q Hat Domain Bound To Coenzyme A With Active Site Lysine Acetylated Length = 276 | Back alignment and structure |
| >pdb|3TO6|A Chain A, Crystal Structure Of Yeast Esa1 Hat Domain Complexed With H4k16coa Bisubstrate Inhibitor Length = 276 | Back alignment and structure |
| >pdb|1M36|A Chain A, Solution Structure Of A Cchc Zinc Finger From Moz Length = 33 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 102 | |||
| 2ozu_A | 284 | Histone acetyltransferase MYST3; structural genomi | 1e-26 | |
| 2pq8_A | 278 | Probable histone acetyltransferase MYST1; MOF, str | 5e-26 | |
| 2ou2_A | 280 | Histone acetyltransferase htatip; structural genom | 6e-26 | |
| 3to7_A | 276 | Histone acetyltransferase ESA1; MYST family; HET: | 7e-25 |
| >2ozu_A Histone acetyltransferase MYST3; structural genomics, structural G consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} SCOP: d.108.1.1 PDB: 2rc4_A* 1m36_A Length = 284 | Back alignment and structure |
|---|
Score = 98.5 bits (245), Expect = 1e-26
Identities = 42/69 (60%), Positives = 51/69 (73%)
Query: 34 PNTRGTKYLQMGKYEMEVWYQSPYPDDYARLPKLYLCEFCLKYMKTKTILFRHANKCVWK 93
P R ++ GKYE+ WY SPYP +Y+RLPKLYLCEFCLKYMK++TIL +H KC W
Sbjct: 8 PQVRCPSVIEFGKYEIHTWYSSPYPQEYSRLPKLYLCEFCLKYMKSRTILQQHMKKCGWF 67
Query: 94 HPPGEEVYR 102
HPP E+YR
Sbjct: 68 HPPANEIYR 76
|
| >2pq8_A Probable histone acetyltransferase MYST1; MOF, structural genomics, structural genomics consortium, SGC; HET: COA; 1.45A {Homo sapiens} PDB: 2giv_A* 3qah_A* 2y0m_A* 3toa_A* 3tob_A* Length = 278 | Back alignment and structure |
|---|
| >2ou2_A Histone acetyltransferase htatip; structural genomics, structural genomics consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} Length = 280 | Back alignment and structure |
|---|
| >3to7_A Histone acetyltransferase ESA1; MYST family; HET: ALY COA; 1.90A {Saccharomyces cerevisiae} PDB: 3to6_A* 1fy7_A* 1mja_A* 1mjb_A* 3to9_A* 1mj9_A* Length = 276 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 102 | |||
| 3to7_A | 276 | Histone acetyltransferase ESA1; MYST family; HET: | 100.0 | |
| 2ou2_A | 280 | Histone acetyltransferase htatip; structural genom | 99.97 | |
| 2pq8_A | 278 | Probable histone acetyltransferase MYST1; MOF, str | 99.97 | |
| 2ozu_A | 284 | Histone acetyltransferase MYST3; structural genomi | 99.97 | |
| 2m0d_A | 30 | Zinc finger and BTB domain-containing protein 17; | 96.09 | |
| 2kvh_A | 27 | Zinc finger and BTB domain-containing protein 32; | 96.04 | |
| 1fv5_A | 36 | First zinc finger of U-shaped; CCHC, protein inter | 95.96 | |
| 2kvg_A | 27 | Zinc finger and BTB domain-containing protein 32; | 95.91 | |
| 2elx_A | 35 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 95.82 | |
| 1srk_A | 35 | Zinc finger protein ZFPM1; classical zinc finger, | 95.81 | |
| 2els_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 95.65 | |
| 2elt_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 95.63 | |
| 2elr_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 95.55 | |
| 2elv_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 95.53 | |
| 2elo_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 95.51 | |
| 1p7a_A | 37 | BF3, BKLF, kruppel-like factor 3; classical zinc f | 95.49 | |
| 1ard_A | 29 | Yeast transcription factor ADR1; transcription reg | 95.43 | |
| 1njq_A | 39 | Superman protein; zinc-finger, peptide-zinc comple | 95.4 | |
| 2m0f_A | 29 | Zinc finger and BTB domain-containing protein 17; | 95.39 | |
| 2kvf_A | 28 | Zinc finger and BTB domain-containing protein 32; | 95.38 | |
| 2epc_A | 42 | Zinc finger protein 32; zinc finger domain, C2H2, | 95.37 | |
| 2elq_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 95.33 | |
| 1znf_A | 27 | 31ST zinc finger from XFIN; zinc finger DNA bindin | 95.33 | |
| 2yte_A | 42 | Zinc finger protein 473; ZF-C2H2, structural genom | 95.26 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 95.15 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 95.15 | |
| 2epv_A | 44 | Zinc finger protein 268; C2H2, zinc finger domain, | 95.1 | |
| 2lvu_A | 26 | Zinc finger and BTB domain-containing protein 17; | 94.09 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 95.07 | |
| 2eoj_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 95.07 | |
| 2el5_A | 42 | Zinc finger protein 268; alternative splicing, DNA | 95.05 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 95.02 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 94.99 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 94.98 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 94.94 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 94.94 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 94.93 | |
| 2elp_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 94.93 | |
| 2ab3_A | 29 | ZNF29; zinc finger protein, beta BETA alpha, RREII | 94.92 | |
| 2lvr_A | 30 | Zinc finger and BTB domain-containing protein 17; | 93.9 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 94.87 | |
| 2ept_A | 41 | Zinc finger protein 32; C2H2, zinc finger domain, | 94.84 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 94.83 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 94.83 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 94.81 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 94.8 | |
| 1rik_A | 29 | E6APC1 peptide; E6-binding domain, zinc finger, hu | 94.79 | |
| 2lvt_A | 29 | Zinc finger and BTB domain-containing protein 17; | 93.79 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 94.78 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 94.75 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 94.73 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 94.73 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 94.72 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 94.7 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 94.7 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 94.69 | |
| 2eoh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 94.68 | |
| 3iuf_A | 48 | Zinc finger protein UBI-D4; structural genomics co | 94.68 | |
| 2elm_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 94.67 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 94.66 | |
| 2emx_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 94.66 | |
| 2epr_A | 48 | POZ-, at HOOK-, and zinc finger-containing protein | 94.64 | |
| 2ytf_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 94.62 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 94.62 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 94.6 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 94.58 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 94.58 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 94.57 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 94.57 | |
| 2en7_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 94.54 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 94.54 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 94.53 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 94.51 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 94.5 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 94.49 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 94.48 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 94.48 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 94.47 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 94.47 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 94.47 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 94.45 | |
| 2yso_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 94.45 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 94.45 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 94.42 | |
| 1va1_A | 37 | Transcription factor SP1; C2H2 type zinc finger, D | 94.42 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 94.41 | |
| 1rim_A | 33 | E6APC2 peptide; E6-binding domain, zinc finger, hu | 94.4 | |
| 2eou_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 94.4 | |
| 1klr_A | 30 | Zinc finger Y-chromosomal protein; transcription; | 94.39 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 94.37 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 94.37 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 94.35 | |
| 2eln_A | 38 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 94.34 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 94.32 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 94.31 | |
| 2en8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 94.3 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 94.29 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 94.28 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 94.27 | |
| 2epx_A | 47 | Zinc finger protein 28 homolog; C2H2, zinc finger | 94.25 | |
| 2m0e_A | 29 | Zinc finger and BTB domain-containing protein 17; | 94.25 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 94.23 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 94.22 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 94.22 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 94.21 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 94.19 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 94.18 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 94.18 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 94.18 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 94.17 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 94.17 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 94.16 | |
| 2enc_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 94.12 | |
| 2en3_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 94.12 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 94.1 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 94.09 | |
| 2yu5_A | 44 | Zinc finger protein 473; ZF-C2H2 domain, structura | 94.07 | |
| 2yrm_A | 43 | B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, | 94.06 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 93.99 | |
| 2epq_A | 45 | POZ-, at HOOK-, and zinc finger-containing protein | 93.98 | |
| 4gzn_C | 60 | ZFP-57, zinc finger protein 57; transcription-DNA | 93.95 | |
| 1sp2_A | 31 | SP1F2; zinc finger, transcription activation; NMR | 93.94 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 93.91 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 93.91 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 93.9 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 93.89 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 93.89 | |
| 2emb_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 93.88 | |
| 1bhi_A | 38 | CRE-BP1, ATF-2; CRE binding protein, transcription | 93.87 | |
| 1yui_A | 54 | GAGA-factor; complex (DNA-binding protein/DNA), ch | 93.86 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 93.85 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 93.84 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 93.84 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 93.79 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 93.78 | |
| 2lv2_A | 85 | Insulinoma-associated protein 1; structural genomi | 93.72 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 93.64 | |
| 1zfd_A | 32 | SWI5; DNA binding motif, zinc finger DNA binding d | 93.58 | |
| 4gzn_C | 60 | ZFP-57, zinc finger protein 57; transcription-DNA | 93.56 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 93.47 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 93.46 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 93.36 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 93.35 | |
| 2lv2_A | 85 | Insulinoma-associated protein 1; structural genomi | 93.33 | |
| 2eoy_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 93.27 | |
| 3uk3_C | 57 | Zinc finger protein 217; transcription factor, DNA | 93.26 | |
| 2epw_A | 46 | Zinc finger protein 268; C2H2, zinc finger domain, | 93.25 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 93.24 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 93.21 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 93.17 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 93.16 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 93.14 | |
| 1paa_A | 30 | Yeast transcription factor ADR1; transcription reg | 93.08 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 93.06 | |
| 3uk3_C | 57 | Zinc finger protein 217; transcription factor, DNA | 93.03 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 93.02 | |
| 2epp_A | 66 | POZ-, at HOOK-, and zinc finger-containing protein | 93.02 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 93.0 | |
| 2gqj_A | 98 | Zinc finger protein KIAA1196; ZF-C2H2 like domain, | 92.77 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 92.74 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 92.64 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 92.64 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 92.54 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 92.53 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 92.44 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 92.38 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 92.33 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 92.3 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 92.01 | |
| 2kfq_A | 32 | FP1; protein, de novo protein; NMR {Synthetic} | 91.86 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 91.86 | |
| 2eod_A | 66 | TNF receptor-associated factor 4; zinc binding, NF | 91.67 | |
| 2lt7_A | 133 | Transcriptional regulator kaiso; zinc finger, doub | 91.45 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 91.39 | |
| 2eod_A | 66 | TNF receptor-associated factor 4; zinc binding, NF | 91.34 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 91.29 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 90.92 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 90.91 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 90.78 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 90.62 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 90.58 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 90.16 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 90.05 | |
| 2ent_A | 48 | Krueppel-like factor 15; zinc binding, transcripti | 90.03 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 89.94 | |
| 1ncs_A | 47 | Peptide M30F, transcriptional factor SWI5; DNA bin | 89.78 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 89.61 | |
| 2lt7_A | 133 | Transcriptional regulator kaiso; zinc finger, doub | 89.58 | |
| 3mjh_B | 34 | Early endosome antigen 1; protein-zinc finger comp | 89.42 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 89.28 | |
| 2ctd_A | 96 | Zinc finger protein 512; zinc binding, two ZF-C2H2 | 89.17 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 89.01 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 88.97 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 88.67 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 88.63 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 88.29 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 87.94 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 87.66 | |
| 2e72_A | 49 | POGO transposable element with ZNF domain; zinc fi | 87.57 | |
| 2gqj_A | 98 | Zinc finger protein KIAA1196; ZF-C2H2 like domain, | 87.43 | |
| 2ctd_A | 96 | Zinc finger protein 512; zinc binding, two ZF-C2H2 | 87.41 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 87.34 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} | 87.1 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 87.06 | |
| 1x6f_A | 88 | Zinc finger protein 462; zinc finger domain, KIAA1 | 86.96 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 86.86 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 86.75 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 86.22 | |
| 1x3c_A | 73 | Zinc finger protein 292; DNA binding, nuclear prot | 86.19 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 86.12 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 85.88 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 85.7 | |
| 1zr9_A | 124 | Zinc finger protein 593; DNA binding, structural g | 85.54 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 85.41 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 85.15 | |
| 2ghf_A | 102 | ZHX1, zinc fingers and homeoboxes protein 1; C2H2 | 84.78 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 84.67 | |
| 2ghf_A | 102 | ZHX1, zinc fingers and homeoboxes protein 1; C2H2 | 84.61 | |
| 2ej4_A | 95 | Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi | 84.55 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 84.54 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 84.43 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} | 84.16 | |
| 2d9k_A | 75 | FLN29 gene product; zinc finger, ZF-TRAF, structur | 83.17 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 82.96 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 82.3 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 82.17 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 81.59 |
| >3to7_A Histone acetyltransferase ESA1; MYST family; HET: ALY COA; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 3to6_A* 1fy7_A* 1mja_A* 1mjb_A* 3to9_A* 1mj9_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=1.1e-33 Score=222.56 Aligned_cols=71 Identities=39% Similarity=0.809 Sum_probs=69.8
Q ss_pred cCCCCCCCCEEEecCeEEeeccCCCCccccCCCCceeeehhhhcccCCHHHHHHHHhhCCCCCCCCccccC
Q psy2116 32 TLPNTRGTKYLQMGKYEMEVWYQSPYPDDYARLPKLYLCEFCLKYMKTKTILFRHANKCVWKHPPGEEVYR 102 (102)
Q Consensus 32 ~~~~~kNI~~V~fG~y~i~tWY~SPYP~e~~~~~~LYICE~ClkY~~s~~~l~rH~~kC~~r~PPG~eIYR 102 (102)
|+|++|||++|+||+|+|+|||+||||+|+.+.++||||||||+||+++.++.+|+.+|+++||||+||||
T Consensus 1 e~tkvkni~~i~~G~~~i~tWY~SPyP~e~~~~~~lyiCe~ClkY~~~~~~~~~H~~~C~~r~PPG~eIYR 71 (276)
T 3to7_A 1 EVARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYR 71 (276)
T ss_dssp CCCCCCCCCEEEETTEEECCSSCCCCCCCCCSCCEEEECTTTCCEESSHHHHHHHHTSCCCSSCSSEEEEE
T ss_pred CcceecccCEEEECCEEEEeeeCCCCcHHhcCCCeEEEccchhhhcCCHHHHHHHhccCCCcCCCCceEEE
Confidence 57999999999999999999999999999999999999999999999999999999999999999999998
|
| >2ou2_A Histone acetyltransferase htatip; structural genomics, structural genomics consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2pq8_A Probable histone acetyltransferase MYST1; MOF, structural genomics, structural genomics consortium, SGC; HET: COA; 1.45A {Homo sapiens} PDB: 2giv_A* 3qah_A* 2y0m_A* 3toa_A* 3tob_A* | Back alignment and structure |
|---|
| >2ozu_A Histone acetyltransferase MYST3; structural genomics, structural G consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} SCOP: d.108.1.1 PDB: 2rc4_A* 1m36_A | Back alignment and structure |
|---|
| >2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B | Back alignment and structure |
|---|
| >2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A | Back alignment and structure |
|---|
| >1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A | Back alignment and structure |
|---|
| >1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A | Back alignment and structure |
|---|
| >2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A | Back alignment and structure |
|---|
| >2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A | Back alignment and structure |
|---|
| >2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A | Back alignment and structure |
|---|
| >2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A | Back alignment and structure |
|---|
| >2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A | Back alignment and structure |
|---|
| >2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} | Back alignment and structure |
|---|
| >1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A | Back alignment and structure |
|---|
| >3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kfq_A FP1; protein, de novo protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A | Back alignment and structure |
|---|
| >2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* | Back alignment and structure |
|---|
| >3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* | Back alignment and structure |
|---|
| >1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A | Back alignment and structure |
|---|
| >2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} | Back alignment and structure |
|---|
| >2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 102 | ||||
| d1fy7a_ | 273 | d.108.1.1 (A:) Histone acetyltransferase ESA1 {Bak | 4e-29 | |
| d2ozua1 | 270 | d.108.1.1 (A:507-776) Histone acetyltransferase MY | 3e-28 | |
| d2giva1 | 271 | d.108.1.1 (A:4-274) Probable histone acetyltransfe | 9e-28 | |
| d1m36a_ | 33 | g.37.1.2 (A:) Monocytic leukemia zinc finger prote | 2e-13 |
| >d1fy7a_ d.108.1.1 (A:) Histone acetyltransferase ESA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 273 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Acyl-CoA N-acyltransferases (Nat) superfamily: Acyl-CoA N-acyltransferases (Nat) family: N-acetyl transferase, NAT domain: Histone acetyltransferase ESA1 species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Score = 103 bits (258), Expect = 4e-29
Identities = 28/67 (41%), Positives = 39/67 (58%)
Query: 36 TRGTKYLQMGKYEMEVWYQSPYPDDYARLPKLYLCEFCLKYMKTKTILFRHANKCVWKHP 95
R + MGKYE+E WY SPYP + +Y+ +F L+Y +K R+ KC +HP
Sbjct: 3 VRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHP 62
Query: 96 PGEEVYR 102
PG E+YR
Sbjct: 63 PGNEIYR 69
|
| >d2ozua1 d.108.1.1 (A:507-776) Histone acetyltransferase MYST3 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 | Back information, alignment and structure |
|---|
| >d2giva1 d.108.1.1 (A:4-274) Probable histone acetyltransferase MYST1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 | Back information, alignment and structure |
|---|
| >d1m36a_ g.37.1.2 (A:) Monocytic leukemia zinc finger protein Moz {Human (Homo sapiens) [TaxId: 9606]} Length = 33 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 102 | |||
| d1fy7a_ | 273 | Histone acetyltransferase ESA1 {Baker's yeast (Sac | 99.97 | |
| d2giva1 | 271 | Probable histone acetyltransferase MYST1 {Human (H | 99.96 | |
| d2ozua1 | 270 | Histone acetyltransferase MYST3 {Human (Homo sapie | 99.96 | |
| d1m36a_ | 33 | Monocytic leukemia zinc finger protein Moz {Human | 99.47 | |
| d2epsa1 | 39 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 96.19 | |
| d1a1ia2 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 96.17 | |
| d1srka_ | 35 | Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc | 96.16 | |
| d2ct1a2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 96.13 | |
| d1x6ha1 | 37 | Transcriptional repressor CTCF {Human (Homo sapien | 96.0 | |
| d2adra1 | 29 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 95.65 | |
| d1x6ha2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 95.62 | |
| d1x6ea1 | 33 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 95.5 | |
| d2csha1 | 53 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 95.4 | |
| d1p7aa_ | 37 | Kruppel-like factor 3, Bklf {Mouse (Mus musculus) | 95.31 | |
| d2glia3 | 30 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 95.05 | |
| d1x6ea2 | 26 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 95.04 | |
| d2cota2 | 38 | Zinc finger and SCAN domain-containing protein 16, | 94.96 | |
| d1ubdc3 | 30 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 94.89 | |
| d1sp1a_ | 29 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 94.85 | |
| d1zfda_ | 32 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 94.81 | |
| d1a1ia1 | 29 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 94.46 | |
| d2drpa2 | 26 | Tramtrack protein (two zinc-finger peptide) {Droso | 94.46 | |
| d1ubdc4 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 93.48 | |
| d2dlka2 | 36 | Zinc finger protein 692, ZNF692 {Human (Homo sapie | 93.4 | |
| d1a1ia3 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 92.91 | |
| d1sp2a_ | 31 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 92.9 | |
| d2csha1 | 53 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 92.79 | |
| d1ncsa_ | 47 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 91.46 | |
| d2adra2 | 31 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 90.73 | |
| d1bboa1 | 28 | Enhancer binding protein {Human (Homo sapiens) [Ta | 90.17 | |
| d1njqa_ | 37 | SUPERMAN zinc finger domain {Thale cress (Arabidop | 89.9 | |
| d2dmda2 | 26 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 89.71 | |
| d1zr9a1 | 67 | Zinc finger protein 593, ZNF593 {Human (Homo sapie | 88.34 | |
| d1ubdc2 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 85.23 | |
| d1bboa2 | 29 | Enhancer binding protein {Human (Homo sapiens) [Ta | 80.82 | |
| d1y0jb1 | 36 | U-shaped transcription factor, different fingers { | 80.21 |
| >d1fy7a_ d.108.1.1 (A:) Histone acetyltransferase ESA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Acyl-CoA N-acyltransferases (Nat) superfamily: Acyl-CoA N-acyltransferases (Nat) family: N-acetyl transferase, NAT domain: Histone acetyltransferase ESA1 species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.97 E-value=5.4e-32 Score=210.85 Aligned_cols=69 Identities=41% Similarity=0.824 Sum_probs=67.5
Q ss_pred CCCCCCCEEEecCeEEeeccCCCCccccCCCCceeeehhhhcccCCHHHHHHHHhhCCCCCCCCccccC
Q psy2116 34 PNTRGTKYLQMGKYEMEVWYQSPYPDDYARLPKLYLCEFCLKYMKTKTILFRHANKCVWKHPPGEEVYR 102 (102)
Q Consensus 34 ~~~kNI~~V~fG~y~i~tWY~SPYP~e~~~~~~LYICE~ClkY~~s~~~l~rH~~kC~~r~PPG~eIYR 102 (102)
.++|||++|+||+|+|+|||+||||+++.+.++||||||||+||+++.+|.+|+.+|+.+||||+||||
T Consensus 1 ~kirnI~~i~~G~y~~~tWY~SPyp~~~~~~~~lyvCe~Clky~~~~~~~~~H~~~C~~r~PPG~eIYr 69 (273)
T d1fy7a_ 1 ARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYR 69 (273)
T ss_dssp CCCCCCCEEEETTEEECCSSCCCCCCCCCSCCEEEECTTTCCEESSHHHHHHHHTSCCCSSCSSEEEEE
T ss_pred CCccccceEEECCeeEcCCcCCCCchhhcCCCeEEEccccCCccCCHHHHHHHHHhCcccCCCCceEEe
Confidence 379999999999999999999999999999999999999999999999999999999999999999997
|
| >d2giva1 d.108.1.1 (A:4-274) Probable histone acetyltransferase MYST1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ozua1 d.108.1.1 (A:507-776) Histone acetyltransferase MYST3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m36a_ g.37.1.2 (A:) Monocytic leukemia zinc finger protein Moz {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|