Diaphorina citri psyllid: psy2121


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60------
MSRELMVMILITGSHKAFALYKAIEEGVNHMWTVSAFQMHPCTIMICDEDATQELRVKTVKYFKRL
cccccEEEEEEEcHHHHHHHHHHHHcccccHHHHccccccccEEEEEcHHHHHHcccccccccccc
**RELMVMILITGSHKAFALYKAIEEGVNHMWTVSAFQMHPCTIMICDEDATQELRVKTVKYFKRL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRELMVMILITGSHKAFALYKAIEEGVNHMWTVSAFQMHPCTIMICDEDATQELRVKTVKYFKRL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glucosamine-6-phosphate isomerase 2 confidentQ9CRC9
Glucosamine-6-phosphate isomerase 2 confidentQ8TDQ7
Glucosamine-6-phosphate isomerase confidentQ29NT9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0006043 [BP]glucosamine catabolic processprobableGO:1901575, GO:0006040, GO:0006041, GO:1901135, GO:0046348, GO:0071704, GO:0008150, GO:0008152, GO:1901136, GO:1901072, GO:1901071, GO:0009056
GO:0006044 [BP]N-acetylglucosamine metabolic processprobableGO:0006040, GO:1901135, GO:0071704, GO:0008150, GO:0008152, GO:1901071
GO:0007340 [BP]acrosome reactionprobableGO:0048610, GO:0019953, GO:0032940, GO:0044699, GO:0000003, GO:0006887, GO:0017156, GO:0006810, GO:0009987, GO:0022414, GO:0044765, GO:0008150, GO:0007338, GO:0051649, GO:0051234, GO:0051179, GO:0051641, GO:0046903, GO:0044702, GO:0016192, GO:0009566, GO:0044763
GO:0016787 [MF]hydrolase activityprobableGO:0003824, GO:0003674
GO:0009058 [BP]biosynthetic processprobableGO:0008150, GO:0008152
GO:0006091 [BP]generation of precursor metabolites and energyprobableGO:0009987, GO:0008150, GO:0008152, GO:0044237
GO:0004342 [MF]glucosamine-6-phosphate deaminase activityprobableGO:0016853, GO:0003824, GO:0019239, GO:0003674, GO:0016861, GO:0016860
GO:0005975 [BP]carbohydrate metabolic processprobableGO:0044238, GO:0008150, GO:0008152, GO:0071704

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1NE7, chain A
Confidence level:very confident
Coverage over the Query: 2-65
View the alignment between query and template
View the model in PyMOL