Seems to trigger calcium oscillations in mammalian eggs. These oscillations serve as the essential trigger for egg activation and early development of the embryo.
Seems to trigger calcium oscillations in mammalian eggs. These oscillations serve as the essential trigger for egg activation and early development of the embryo.
Mus musculus (taxid: 10090)
EC: 3
EC: .
EC: 5
EC: .
EC: 9
EC: 9
EC: .
EC: 6
Close Homologs in the Non-Redundant Database Detected by BLAST
>gi|91079050|ref|XP_975109.1| PREDICTED: similar to GA19983-PA [Tribolium castaneum] gi|270003660|gb|EFA00108.1| hypothetical protein TcasGA2_TC002924 [Tribolium castaneum]
The set of proteins recognized by This model includes a closely related pair from Bacillus subtilis, one of which is uncharacterized but included as a member of the orthologous set [Central intermediary metabolism, Amino sugars]. Length = 259
Score = 73.3 bits (181), Expect = 6e-18
Identities = 20/49 (40%), Positives = 27/49 (55%)
Query: 7 VMILITGSHKAFALYKAIEEGVNHMWTVSAFQMHPCTIMICDEDATQEL 55
+++L TG KA A+ KA+E V S Q+HP +I DE A EL
Sbjct: 184 ILLLATGEGKAEAVKKALEGPVTEECPASILQLHPNVTVILDEAAASEL 232
The reaction is an aldo-keto isomerization coupled with an amination or deamination. It is the last step of the metabolic pathway of N-acetyl-D-glucosamine-6-phosphate (GlcNAc6P). GlcN6P deaminase is a hexameric enzyme that is allosterically activated by GlcNAc6P. Length = 232
>gnl|CDD|223440 COG0363, NagB, 6-phosphogluconolactonase/Glucosamine-6-phosphate isomerase/deaminase [Carbohydrate transport and metabolism]
Score = 48.1 bits (114), Expect = 1e-08
Identities = 11/45 (24%), Positives = 18/45 (40%)
Query: 3 RELMVMILITGSHKAFALYKAIEEGVNHMWTVSAFQMHPCTIMIC 47
R V++L+ G K L + E GV + + I+I
Sbjct: 125 RAGTVIVLVDGRKKVDYLCQNTEPGVIENGIFADIRGKEKDIVIV 169
RPI catalyzes the reversible conversion of ribose-5-phosphate to ribulose 5-phosphate, the first step of the non-oxidative branch of the pentose phosphate pathway. GlcN6P deaminase catalyzes the reversible conversion of GlcN6P to D-fructose-6-phosphate (Fru6P) and ammonium, the last step of the metabolic pathway of N-acetyl-D-glucosamine-6-phosphate. 6PGL converts 6-phosphoglucono-1,5-lactone to 6-phosphogluconate, the second step of the oxidative phase of the pentose phosphate pathway. Length = 169
Score = 34.0 bits (78), Expect = 0.002
Identities = 16/49 (32%), Positives = 25/49 (51%)
Query: 7 VMILITGSHKAFALYKAIEEGVNHMWTVSAFQMHPCTIMICDEDATQEL 55
+++++ G KA L K ++ V S Q+HP +I DE A EL
Sbjct: 189 LLLIVNGKGKAQILKKVLQGPVTEDVPASILQLHPNLTVILDEAAAAEL 237
The set of proteins recognized by this model includes a closely related pair from Bacillus subtilis, one of which is uncharacterized but included as a member of the orthologous set.
>cd01399 GlcN6P_deaminase GlcN6P_deaminase: Glucosamine-6-phosphate (GlcN6P) deaminase subfamily; GlcN6P deaminase catalyzes the reversible conversion of GlcN6P to D-fructose-6-phosphate (Fru6P) and ammonium
The reaction is an aldo-keto isomerization coupled with an amination or deamination. It is the last step of the metabolic pathway of N-acetyl-D-glucosamine-6-phosphate (GlcNAc6P). GlcN6P deaminase is a hexameric enzyme that is allosterically activated by GlcNAc6P.
>cd00458 SugarP_isomerase SugarP_isomerase: Sugar Phosphate Isomerase family; includes type A ribose 5-phosphate isomerase (RPI_A), glucosamine-6-phosphate (GlcN6P) deaminase, and 6-phosphogluconolactonase (6PGL)
RPI catalyzes the reversible conversion of ribose-5-phosphate to ribulose 5-phosphate, the first step of the non-oxidative branch of the pentose phosphate pathway. GlcN6P deaminase catalyzes the reversible conversion of GlcN6P to D-fructose-6-phosphate (Fru6P) and ammonium, the last step of the metabolic pathway of N-acetyl-D-glucosamine-6-phosphate. 6PGL converts 6-phosphoglucono-1,5-lactone to 6-phosphogluconate, the second step of the oxidative phase of the pentose phosphate pathway.
>cd01400 6PGL 6PGL: 6-Phosphogluconolactonase (6PGL) subfamily; 6PGL catalyzes the second step of the oxidative phase of the pentose phosphate pathway, the hydrolyzation of 6-phosphoglucono-1,5-lactone (delta form) to 6-phosphogluconate
6PGL is thought to guard against the accumulation of the delta form of the lactone, which may be toxic through its reaction with endogenous cellular nucleophiles.
>PF01182 Glucosamine_iso: Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase; InterPro: IPR006148 This domain is characteristic of the enzymes 6-phosphogluconolactonase (3
1.1.31 from EC), Glucosamine-6-phosphate isomerase (3.5.99.6 from EC), and Galactosamine-6-phosphate isomerase. 6-Phosphogluconolactonase is the enzyme responsible for the hydrolysis of 6-phosphogluconolactone to 6-phosphogluconate, the second step in the pentose phosphate pathway. Glucosamine-6-phosphate isomerase (or Glucosamine 6-phosphate deaminase) is the enzyme responsible for the conversion of D-glucosamine 6-phosphate into D-fructose 6-phosphate []. It is the last specific step in the pathway for N-acetylglucosamine (GlcNAC) utilization in bacteria such as Escherichia coli (gene nagB) or in fungi such as Candida albicans (gene NAG1).; GO: 0005975 carbohydrate metabolic process; PDB: 3CSS_A 3CH7_A 1Y89_B 3TX2_A 2BKX_B 2BKV_B 3E15_B 1HOR_B 1JT9_A 1HOT_A ....
>PF04198 Sugar-bind: Putative sugar-binding domain; InterPro: IPR007324 This probable domain is found in bacterial transcriptional regulators such as DeoR and SorC
One of these proteins, Q8U7I7 from SWISSPROT, has an N-terminal helix-turn-helix IPR000792 from INTERPRO that binds to DNA. This domain is probably the ligand regulator binding region. SorC is regulated by sorbose and other members of this family are likely to be regulated by other sugar substrates.; GO: 0030246 carbohydrate binding; PDB: 3KV1_A 3EFB_C 2W48_A 3BXH_A 3BXE_A 2OKG_A 3BXF_A 3BXG_A 2R5F_A 2O0M_A ....
Crystal Structure Of Glucosamine-6-phosphate Deamin
2e-14
>pdb|1NE7|A Chain A, Human Glucosamine-6-Phosphate Deaminase Isomerase At 1.75 A Resolution Complexed With N-Acetyl-Glucosamine-6-Phosphate And 2-Deoxy-2-Amino-Glucitol-6-Phosphate Length = 289
>pdb|1HOR|A Chain A, Structure And Catalytic Mechanism Of Glucosamine 6-phosphate Deaminase From Escherichia Coli At 2.1 Angstroms Resolution Length = 266