Diaphorina citri psyllid: psy2158


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10
MSYDPQSGNVGLVIDSIGPGDEGEYTCCARNEFGEAICAVFIQPECVNVPLYQQRMQQMQQHRSEKTAYSNGSQSIVSEYSGAILVMKVLQSVQIFKM
ccccccccCEEEEEcccccccccCEEEEEEcccEEEEEEEEEECccccccHHHHHHHHEEEEEEEEEEEEcccCEEEEEEEEEEEEEEEEEEEEEEEc
**YDPQSGNVGLVIDSIGPGDEGEYTCCARNEFGEAICAVFIQPECVNVPLYQ**********************IVSEYSGAILVMKVLQSVQIFKM
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSYDPQSGNVGLVIDSIGPGDEGEYTCCARNEFGEAICAVFIQPECVNVPLYQQRMQQMQQHRSEKTAYSNGSQSIVSEYSGAILVMKVLQSVQIFKM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0000794 [CC]condensed nuclear chromosomeprobableGO:0031974, GO:0043229, GO:0043228, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0005694, GO:0000793, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0030017 [CC]sarcomereprobableGO:0005737, GO:0005575, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0030016, GO:0044424, GO:0044444, GO:0043228, GO:0043292, GO:0043226, GO:0044422, GO:0044449
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0007520 [BP]myoblast fusionprobableGO:0030154, GO:0061061, GO:0014706, GO:0000768, GO:0006949, GO:0009653, GO:0007275, GO:0044699, GO:0007517, GO:0051146, GO:0007519, GO:0048513, GO:0048869, GO:0035914, GO:0048646, GO:0032502, GO:0032501, GO:0014902, GO:0009987, GO:0009888, GO:0044767, GO:0044763, GO:0048731, GO:0044707, GO:0048856, GO:0060537, GO:0060538, GO:0008150, GO:0042692
GO:0016203 [BP]muscle attachmentprobableGO:0032502, GO:0007517, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0061061, GO:0048513, GO:0008150, GO:0060538, GO:0048731, GO:0007275, GO:0044699
GO:0007076 [BP]mitotic chromosome condensationprobableGO:0071103, GO:0090304, GO:0034641, GO:0006807, GO:0022402, GO:0016043, GO:0007067, GO:0044699, GO:0006139, GO:0044260, GO:1901360, GO:0000280, GO:0006323, GO:0071704, GO:0071840, GO:0000278, GO:0044238, GO:0009987, GO:0006725, GO:0008150, GO:0008152, GO:0007059, GO:0046483, GO:0006996, GO:0030261, GO:0007049, GO:0000070, GO:0000819, GO:0051276, GO:0044237, GO:0043170, GO:0048285, GO:0006259, GO:0044763
GO:0007062 [BP]sister chromatid cohesionprobableGO:0006996, GO:0051276, GO:0022402, GO:0009987, GO:0016043, GO:0008150, GO:0044763, GO:0044699, GO:0071840, GO:0007059, GO:0007049
GO:0008307 [MF]structural constituent of muscleprobableGO:0003674, GO:0005198
GO:0007498 [BP]mesoderm developmentprobableGO:0032502, GO:0048856, GO:0008150, GO:0009888
GO:0035206 [BP]regulation of hemocyte proliferationprobableGO:0042127, GO:0050793, GO:0050794, GO:0008150, GO:0002682, GO:0051239, GO:0065007, GO:0050789
GO:0040011 [BP]locomotionprobableGO:0008150

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3V2A, chain R
Confidence level:very confident
Coverage over the Query: 12-41
View the alignment between query and template
View the model in PyMOL
Template: 2NZI, chain A
Confidence level:very confident
Coverage over the Query: 7-84
View the alignment between query and template
View the model in PyMOL