Psyllid ID: psy2158
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 98 | ||||||
| 357607509 | 14404 | kettin protein [Danaus plexippus] | 0.755 | 0.005 | 0.584 | 2e-18 | |
| 156900686 | 4454 | Kettin1 protein [Helicoverpa armigera] | 0.826 | 0.018 | 0.548 | 2e-17 | |
| 195170804 | 2385 | GL24634 [Drosophila persimilis] gi|19411 | 0.897 | 0.036 | 0.484 | 2e-16 | |
| 198466529 | 4811 | GA15129 [Drosophila pseudoobscura pseudo | 0.897 | 0.018 | 0.484 | 3e-16 | |
| 328711567 | 6663 | PREDICTED: titin-like [Acyrthosiphon pis | 0.948 | 0.013 | 0.451 | 4e-16 | |
| 242022532 | 4792 | conserved hypothetical protein [Pediculu | 0.734 | 0.015 | 0.452 | 3e-15 | |
| 168823429 | 4816 | kettin protein [Bombyx mori] gi|18700457 | 0.826 | 0.016 | 0.536 | 4e-15 | |
| 345496576 | 7014 | PREDICTED: titin-like [Nasonia vitripenn | 0.806 | 0.011 | 0.493 | 6e-15 | |
| 195587136 | 313 | GD13413 [Drosophila simulans] gi|1941953 | 0.887 | 0.277 | 0.473 | 8e-15 | |
| 3243131 | 880 | titin [Drosophila melanogaster] | 0.887 | 0.098 | 0.473 | 1e-14 |
| >gi|357607509|gb|EHJ65548.1| kettin protein [Danaus plexippus] | Back alignment and taxonomy information |
|---|
Score = 96.3 bits (238), Expect = 2e-18, Method: Composition-based stats.
Identities = 45/77 (58%), Positives = 59/77 (76%), Gaps = 3/77 (3%)
Query: 1 MSYDPQSGNVGLVIDSIGPGDEGEYTCCARNEFGEAICAVFIQPECVNVPLYQQRMQQMQ 60
MSY+ Q+G+V L+I IGPGDEGEYTC ARN++GEAIC+V+IQPE V VP + QQ
Sbjct: 113 MSYNEQTGDVSLLIKQIGPGDEGEYTCTARNQYGEAICSVYIQPEGVPVPTQRASQQQSY 172
Query: 61 QH---RSEKTAYSNGSQ 74
+H +S+K AY+NGS+
Sbjct: 173 RHQSRQSQKYAYTNGSE 189
|
Source: Danaus plexippus Species: Danaus plexippus Genus: Danaus Family: Nymphalidae Order: Lepidoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|156900686|gb|ABU96746.1| Kettin1 protein [Helicoverpa armigera] | Back alignment and taxonomy information |
|---|
| >gi|195170804|ref|XP_002026201.1| GL24634 [Drosophila persimilis] gi|194111096|gb|EDW33139.1| GL24634 [Drosophila persimilis] | Back alignment and taxonomy information |
|---|
| >gi|198466529|ref|XP_001354025.2| GA15129 [Drosophila pseudoobscura pseudoobscura] gi|198150642|gb|EAL29762.2| GA15129 [Drosophila pseudoobscura pseudoobscura] | Back alignment and taxonomy information |
|---|
| >gi|328711567|ref|XP_003244574.1| PREDICTED: titin-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|242022532|ref|XP_002431694.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212517002|gb|EEB18956.1| conserved hypothetical protein [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|168823429|ref|NP_001108348.1| kettin protein [Bombyx mori] gi|18700457|dbj|BAB85196.1| BMKETTIN [Bombyx mori] gi|22474512|dbj|BAC10617.1| KETTIN [Bombyx mori] | Back alignment and taxonomy information |
|---|
| >gi|345496576|ref|XP_001602095.2| PREDICTED: titin-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|195587136|ref|XP_002083321.1| GD13413 [Drosophila simulans] gi|194195330|gb|EDX08906.1| GD13413 [Drosophila simulans] | Back alignment and taxonomy information |
|---|
| >gi|3243131|gb|AAC23966.1| titin [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 98 | ||||||
| FB|FBgn0086906 | 18 | sls "sallimus" [Drosophila mel | 0.887 | 4.833 | 0.452 | 2.3e-12 |
| FB|FBgn0086906 sls "sallimus" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 191 (72.3 bits), Expect = 2.3e-12, P = 2.3e-12
Identities = 43/95 (45%), Positives = 57/95 (60%)
Query: 1 MSYDPQSGNVGLVIDSIGPGDEGEYTCCARNEFGEAICAVFIQPECVNVPLYXXXXXXXX 60
MSY+ +G+V L+I+ IGPGDEGEYTC ARN++GEAIC+V+IQPE +P
Sbjct: 135 MSYNEATGDVSLLINQIGPGDEGEYTCTARNQYGEAICSVYIQPEGAPMP------ALQP 188
Query: 61 XHRSEKTAYSNGSQ--SIVSEYSGAILVMKVLQSV 93
EK YSNG SI E+ ++L+ V
Sbjct: 189 IQNLEKNIYSNGYSYTSIEEEFRVDTFEYRLLREV 223
Parameters:
V=100
filter=SEG
E=0.001
ctxfactor=1.00
Query ----- As Used ----- ----- Computed ----
Frame MatID Matrix name Lambda K H Lambda K H
+0 0 BLOSUM62 0.318 0.134 0.397 same same same
Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a
Query
Frame MatID Length Eff.Length E S W T X E2 S2
+0 0 98 89 0.00091 102 3 11 22 0.49 29
29 0.50 30
Statistics:
Database: /share/blast/go-seqdb.fasta
Title: go_20130330-seqdb.fasta
Posted: 5:47:42 AM PDT Apr 1, 2013
Created: 5:47:42 AM PDT Apr 1, 2013
Format: XDF-1
# of letters in database: 169,044,731
# of sequences in database: 368,745
# of database sequences satisfying E: 1
No. of states in DFA: 524 (56 KB)
Total size of DFA: 103 KB (2072 KB)
Time to generate neighborhood: 0.00u 0.00s 0.00t Elapsed: 00:00:03
No. of threads or processors used: 24
Search cpu time: 8.67u 0.08s 8.75t Elapsed: 00:00:12
Total cpu time: 8.67u 0.08s 8.75t Elapsed: 00:00:15
Start: Thu Aug 15 12:17:12 2013 End: Thu Aug 15 12:17:27 2013
|
|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 98 | |||
| pfam07679 | 90 | pfam07679, I-set, Immunoglobulin I-set domain | 5e-07 | |
| cd05760 | 77 | cd05760, Ig2_PTK7, Second immunoglobulin (Ig)-like | 9e-04 | |
| cd00096 | 74 | cd00096, Ig, Immunoglobulin domain | 0.001 | |
| smart00408 | 63 | smart00408, IGc2, Immunoglobulin C-2 Type | 0.002 | |
| smart00410 | 85 | smart00410, IG_like, Immunoglobulin like | 0.002 | |
| smart00409 | 85 | smart00409, IG, Immunoglobulin | 0.002 | |
| cd05857 | 85 | cd05857, Ig2_FGFR, Second immunoglobulin (Ig)-like | 0.002 | |
| cd05875 | 77 | cd05875, Ig6_hNeurofascin_like, Sixth immunoglobul | 0.003 |
| >gnl|CDD|191810 pfam07679, I-set, Immunoglobulin I-set domain | Back alignment and domain information |
|---|
Score = 43.4 bits (103), Expect = 5e-07
Identities = 15/41 (36%), Positives = 20/41 (48%)
Query: 1 MSYDPQSGNVGLVIDSIGPGDEGEYTCCARNEFGEAICAVF 41
+ G L I ++ P DEG+YTC A N GEA +
Sbjct: 47 FKVTYEGGTYTLTISNVQPDDEGKYTCVATNSAGEAEASAE 87
|
Length = 90 |
| >gnl|CDD|143237 cd05760, Ig2_PTK7, Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4 | Back alignment and domain information |
|---|
| >gnl|CDD|143165 cd00096, Ig, Immunoglobulin domain | Back alignment and domain information |
|---|
| >gnl|CDD|197706 smart00408, IGc2, Immunoglobulin C-2 Type | Back alignment and domain information |
|---|
| >gnl|CDD|214653 smart00410, IG_like, Immunoglobulin like | Back alignment and domain information |
|---|
| >gnl|CDD|214652 smart00409, IG, Immunoglobulin | Back alignment and domain information |
|---|
| >gnl|CDD|143265 cd05857, Ig2_FGFR, Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor | Back alignment and domain information |
|---|
| >gnl|CDD|143283 cd05875, Ig6_hNeurofascin_like, Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 98 | |||
| cd05735 | 88 | Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down | 99.22 | |
| cd05762 | 98 | Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of | 99.19 | |
| cd05854 | 85 | Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig | 99.08 | |
| cd05892 | 75 | Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like | 99.07 | |
| cd05853 | 85 | Ig6_Contactin-4 Sixth Ig domain of contactin-4. Ig | 99.03 | |
| cd04970 | 85 | Ig6_Contactin_like Sixth Ig domain of contactin. I | 99.03 | |
| cd05893 | 75 | Ig_Palladin_C C-terminal immunoglobulin (Ig)-like | 98.99 | |
| cd05744 | 75 | Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain | 98.98 | |
| KOG3513|consensus | 1051 | 98.97 | ||
| cd05748 | 74 | Ig_Titin_like Immunoglobulin (Ig)-like domain of t | 98.95 | |
| cd04974 | 90 | Ig3_FGFR Third immunoglobulin (Ig)-like domain of | 98.89 | |
| cd05894 | 86 | Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of card | 98.87 | |
| cd05870 | 98 | Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain o | 98.87 | |
| cd05852 | 73 | Ig5_Contactin-1 Fifth Ig domain of contactin-1. Ig | 98.86 | |
| cd05876 | 71 | Ig3_L1-CAM Third immunoglobulin (Ig)-like domain o | 98.85 | |
| cd05725 | 69 | Ig3_Robo Third immunoglobulin (Ig)-like domain in | 98.84 | |
| cd05732 | 96 | Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like dom | 98.82 | |
| cd05726 | 90 | Ig4_Robo Fhird immunoglobulin (Ig)-like domain in | 98.82 | |
| cd05858 | 90 | Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain o | 98.8 | |
| cd05763 | 75 | Ig_1 Subgroup of the immunoglobulin (Ig) superfami | 98.8 | |
| cd05865 | 96 | Ig1_NCAM-1 First immunoglobulin (Ig)-like domain o | 98.8 | |
| cd05869 | 97 | Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain o | 98.79 | |
| cd05745 | 74 | Ig3_Peroxidasin Third immunoglobulin (Ig)-like dom | 98.78 | |
| cd05867 | 76 | Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like do | 98.77 | |
| cd05765 | 81 | Ig_3 Subgroup of the immunoglobulin (Ig) superfami | 98.77 | |
| cd04971 | 81 | Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of | 98.76 | |
| cd05731 | 71 | Ig3_L1-CAM_like Third immunoglobulin (Ig)-like dom | 98.74 | |
| cd04969 | 73 | Ig5_Contactin_like Fifth Ig domain of contactin. I | 98.73 | |
| cd05855 | 79 | Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of T | 98.73 | |
| cd05857 | 85 | Ig2_FGFR Second immunoglobulin (Ig)-like domain of | 98.73 | |
| cd04978 | 76 | Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like | 98.73 | |
| cd05851 | 88 | Ig3_Contactin-1 Third Ig domain of contactin-1. Ig | 98.73 | |
| cd05723 | 71 | Ig4_Neogenin Fourth immunoglobulin (Ig)-like domai | 98.73 | |
| cd05863 | 67 | Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain | 98.72 | |
| cd05737 | 92 | Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)- | 98.71 | |
| cd05746 | 69 | Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like do | 98.71 | |
| cd04968 | 88 | Ig3_Contactin_like Third Ig domain of contactin. I | 98.71 | |
| cd04975 | 101 | Ig4_SCFR_like Fourth immunoglobulin (Ig)-like doma | 98.7 | |
| cd05730 | 95 | Ig3_NCAM-1_like Third immunoglobulin (Ig)-like dom | 98.7 | |
| cd05856 | 82 | Ig2_FGFRL1-like Second immunoglobulin (Ig)-like do | 98.7 | |
| cd05736 | 76 | Ig2_Follistatin_like Second immunoglobulin (Ig)-li | 98.7 | |
| cd05773 | 109 | Ig8_hNephrin_like Eighth immunoglobulin-like domai | 98.69 | |
| cd05750 | 75 | Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain | 98.68 | |
| cd05742 | 84 | Ig1_VEGFR_like First immunoglobulin (Ig)-like doma | 98.67 | |
| cd05764 | 74 | Ig_2 Subgroup of the immunoglobulin (Ig) superfami | 98.67 | |
| PF07679 | 90 | I-set: Immunoglobulin I-set domain; InterPro: IPR0 | 98.66 | |
| cd05859 | 101 | Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like do | 98.66 | |
| cd05868 | 76 | Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain o | 98.65 | |
| cd04976 | 71 | Ig2_VEGFR Second immunoglobulin (Ig)-like domain o | 98.65 | |
| cd05760 | 77 | Ig2_PTK7 Second immunoglobulin (Ig)-like domain of | 98.64 | |
| cd05864 | 70 | Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain | 98.63 | |
| cd04972 | 90 | Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) o | 98.63 | |
| cd05743 | 78 | Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domai | 98.63 | |
| cd05747 | 92 | Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like | 98.61 | |
| cd05895 | 76 | Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domai | 98.61 | |
| cd05866 | 92 | Ig1_NCAM-2 First immunoglobulin (Ig)-like domain o | 98.6 | |
| cd05891 | 92 | Ig_M-protein_C C-terminal immunoglobulin (Ig)-like | 98.58 | |
| cd05734 | 79 | Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain | 98.56 | |
| cd04977 | 92 | Ig1_NCAM-1_like First immunoglobulin (Ig)-like dom | 98.56 | |
| cd05738 | 74 | Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-l | 98.53 | |
| cd05728 | 85 | Ig4_Contactin-2-like Fourth Ig domain of the neura | 98.52 | |
| cd05862 | 86 | Ig1_VEGFR First immunoglobulin (Ig)-like domain of | 98.47 | |
| cd04973 | 79 | Ig1_FGFR First immunoglobulin (Ig)-like domain of | 98.46 | |
| cd05756 | 94 | Ig1_IL1R_like First immunoglobulin (Ig)-like domai | 98.42 | |
| cd05740 | 91 | Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domai | 98.42 | |
| cd05861 | 84 | Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like | 98.4 | |
| cd05724 | 86 | Ig2_Robo Second immunoglobulin (Ig)-like domain in | 98.37 | |
| cd05739 | 69 | Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-li | 98.35 | |
| cd05758 | 98 | Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like do | 98.34 | |
| cd05714 | 106 | Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of cho | 98.33 | |
| cd05729 | 85 | Ig2_FGFR_like Second immunoglobulin (Ig)-like doma | 98.3 | |
| cd05754 | 85 | Ig3_Perlecan_like Third immunoglobulin (Ig)-like d | 98.27 | |
| cd05713 | 100 | Ig_MOG_like Immunoglobulin (Ig)-like domain of mye | 98.24 | |
| KOG3513|consensus | 1051 | 98.24 | ||
| cd05757 | 92 | Ig2_IL1R_like Second immunoglobulin (Ig)-like doma | 98.23 | |
| cd05877 | 106 | Ig_LP_like Immunoglobulin (Ig)-like domain of huma | 98.17 | |
| cd05898 | 98 | Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain | 98.15 | |
| cd07693 | 100 | Ig1_Robo First immunoglobulin (Ig)-like domain in | 98.13 | |
| cd05886 | 99 | Ig1_Nectin-1_like First immunoglobulin (Ig) domain | 98.13 | |
| cd05888 | 100 | Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain | 98.11 | |
| cd07701 | 95 | Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)- | 98.1 | |
| cd05871 | 91 | Ig_Semaphorin_classIII Immunoglobulin (Ig)-like do | 98.09 | |
| cd05771 | 139 | IgC_Tapasin_R Tapasin-R immunoglobulin-like domain | 98.08 | |
| cd05733 | 77 | Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like dom | 98.06 | |
| cd05882 | 95 | Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)- | 98.05 | |
| cd05848 | 94 | Ig1_Contactin-5 First Ig domain of contactin-5. Ig | 98.04 | |
| cd05900 | 112 | Ig_Aggrecan Immunoglobulin (Ig)-like domain of the | 98.04 | |
| cd05874 | 77 | Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of | 98.02 | |
| cd05878 | 110 | Ig_Aggrecan_like Immunoglobulin (Ig)-like domain o | 98.01 | |
| cd05717 | 95 | Ig1_Necl-1-3_like First (N-terminal) immunoglobuli | 98.01 | |
| cd05901 | 117 | Ig_Versican Immunoglobulin (Ig)-like domain of the | 98.0 | |
| cd05850 | 94 | Ig1_Contactin-2 First Ig domain of contactin-2. Ig | 98.0 | |
| cd05849 | 93 | Ig1_Contactin-1 First Ig domain of contactin-1. Ig | 97.98 | |
| cd05718 | 98 | Ig1_PVR_like First immunoglobulin (Ig) domain of p | 97.98 | |
| cd05722 | 95 | Ig1_Neogenin First immunoglobulin (Ig)-like domain | 97.97 | |
| cd05875 | 77 | Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-li | 97.95 | |
| cd07702 | 72 | Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain | 97.92 | |
| cd05879 | 116 | Ig_P0 Immunoglobulin (Ig)-like domain of Protein z | 97.91 | |
| KOG4194|consensus | 873 | 97.9 | ||
| cd04967 | 91 | Ig1_Contactin First Ig domain of contactin. Ig1_Co | 97.89 | |
| cd05902 | 110 | Ig_Neurocan Immunoglobulin (Ig)-like domain of the | 97.89 | |
| cd05887 | 96 | Ig1_Nectin-3_like First immunoglobulin (Ig) domain | 97.85 | |
| smart00410 | 86 | IG_like Immunoglobulin like. IG domains that canno | 97.82 | |
| smart00409 | 86 | IG Immunoglobulin. | 97.82 | |
| smart00408 | 63 | IGc2 Immunoglobulin C-2 Type. | 97.8 | |
| cd04979 | 89 | Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of | 97.79 | |
| cd05897 | 95 | Ig2_IL1R2_like Second immunoglobulin (Ig)-like dom | 97.77 | |
| PHA02826 | 227 | IL-1 receptor-like protein; Provisional | 97.72 | |
| cd05880 | 115 | Ig_EVA1 Immunoglobulin (Ig)-like domain of epithel | 97.72 | |
| cd07690 | 94 | Ig1_CD4 First immunoglobulin (Ig) domain of CD4. I | 97.7 | |
| cd05715 | 116 | Ig_P0-like Immunoglobulin (Ig)-like domain of Prot | 97.68 | |
| PHA02785 | 326 | IL-beta-binding protein; Provisional | 97.64 | |
| cd05846 | 97 | Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain | 97.62 | |
| cd05753 | 83 | Ig2_FcgammaR_like Second immunoglobulin (Ig)-like | 97.59 | |
| cd05775 | 97 | Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig) | 97.55 | |
| PHA02785 | 326 | IL-beta-binding protein; Provisional | 97.54 | |
| cd05749 | 81 | Ig2_Tyro3_like Second immunoglobulin (Ig)-like dom | 97.52 | |
| cd05774 | 105 | Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain | 97.51 | |
| cd05727 | 96 | Ig2_Contactin-2-like Second Ig domain of the neura | 97.51 | |
| cd05860 | 101 | Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of | 97.44 | |
| KOG4222|consensus | 1281 | 97.44 | ||
| cd05752 | 78 | Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like do | 97.41 | |
| cd04983 | 109 | IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V | 97.41 | |
| PF13927 | 75 | Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1V | 97.39 | |
| cd00099 | 105 | IgV Immunoglobulin variable domain (IgV). IgV: Imm | 97.37 | |
| cd05873 | 87 | Ig_Sema4D_like Immunoglobulin (Ig)-like domain of | 97.36 | |
| cd05741 | 92 | Ig_CEACAM_D1_like First immunoglobulin (Ig)-like d | 97.36 | |
| cd05896 | 104 | Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like | 97.32 | |
| PF07686 | 114 | V-set: Immunoglobulin V-set domain; InterPro: IPR0 | 97.31 | |
| KOG4221|consensus | 1381 | 97.24 | ||
| PF00047 | 64 | ig: Immunoglobulin domain The Prosite family only | 97.24 | |
| cd05889 | 96 | Ig1_DNAM-1_like First immunoglobulin (Ig) domain o | 97.2 | |
| PF13895 | 80 | Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V | 97.17 | |
| cd05845 | 95 | Ig2_L1-CAM_like Second immunoglobulin (Ig)-like do | 97.02 | |
| PHA02633 | 63 | hypothetical protein; Provisional | 96.99 | |
| cd05716 | 98 | Ig_pIgR Immunoglobulin (Ig)-like domain in the pol | 96.81 | |
| smart00406 | 81 | IGv Immunoglobulin V-Type. | 96.78 | |
| cd05712 | 119 | Ig_Siglec_N Immunoglobulin (Ig) domain at the N te | 96.7 | |
| cd05881 | 95 | Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)- | 96.69 | |
| PHA02826 | 227 | IL-1 receptor-like protein; Provisional | 96.6 | |
| cd05899 | 110 | IgV_TCR_beta Immunoglobulin (Ig) variable (V) doma | 96.59 | |
| cd05751 | 91 | Ig1_LILRB1_like First immunoglobulin (Ig)-like dom | 96.57 | |
| cd04980 | 106 | IgV_L_kappa Immunoglobulin (Ig) light chain, kappa | 96.55 | |
| cd04984 | 98 | IgV_L_lambda Immunoglobulin (Ig) lambda light chai | 96.51 | |
| cd00096 | 74 | Ig Immunoglobulin domain. Ig: immunoglobulin (Ig) | 96.5 | |
| cd04982 | 116 | IgV_TCR_gamma Immunoglobulin (Ig) variable (V) dom | 96.46 | |
| cd07706 | 116 | IgV_TCR_delta Immunoglobulin (Ig) variable (V) dom | 96.4 | |
| PHA03376 | 221 | BARF1; Provisional | 96.26 | |
| cd07700 | 107 | IgV_CD8_beta Immunoglobulin (Ig) like domain of CD | 96.2 | |
| KOG4222|consensus | 1281 | 96.16 | ||
| cd05872 | 85 | Ig_Sema4B_like Immunoglobulin (Ig)-like domain of | 96.15 | |
| PHA02987 | 189 | Ig domain OX-2-like protein; Provisional | 96.04 | |
| cd05759 | 82 | Ig2_KIRREL3-like Second immunoglobulin (Ig)-like d | 95.83 | |
| cd05720 | 104 | Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD | 95.81 | |
| KOG4221|consensus | 1381 | 95.68 | ||
| KOG4194|consensus | 873 | 95.62 | ||
| cd05885 | 80 | Ig2_Necl-4 Second immunoglobulin (Ig)-like domain | 95.56 | |
| cd04981 | 117 | IgV_H Immunoglobulin (Ig) heavy chain (H), variabl | 95.18 | |
| cd05711 | 94 | Ig_FcalphaRI Immunoglobulin (IG)-like domain of of | 93.5 | |
| PF08204 | 130 | V-set_CD47: CD47 immunoglobulin-like domain; Inter | 90.77 | |
| cd07694 | 88 | Ig2_CD4 Second immunoglobulin (Ig) domain of CD4. | 90.17 | |
| PF11465 | 108 | Receptor_2B4: Natural killer cell receptor 2B4; In | 88.37 | |
| cd00098 | 95 | IgC Immunoglobulin Constant domain. IgC: Immunoglo | 87.59 | |
| cd07691 | 69 | Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain | 87.57 | |
| cd05721 | 115 | IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic | 86.9 | |
| KOG4597|consensus | 560 | 86.06 | ||
| PF07354 | 271 | Sp38: Zona-pellucida-binding protein (Sp38); Inter | 84.71 | |
| PHA03269 | 566 | envelope glycoprotein C; Provisional | 84.41 | |
| PHA02982 | 251 | hypothetical protein; Provisional | 81.24 | |
| cd05761 | 82 | Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like | 80.51 |
| >cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM) | Back alignment and domain information |
|---|
Probab=99.22 E-value=4e-11 Score=74.97 Aligned_cols=42 Identities=24% Similarity=0.266 Sum_probs=40.2
Q ss_pred EEEEEcCCCCCCCeeEEEEEeCCCCceEEEEEEEEeecCCCh
Q psy2158 10 VGLVIDSIGPGDEGEYTCCARNEFGEAICAVFIQPECVNVPL 51 (98)
Q Consensus 10 ~~L~I~~v~~~D~G~YtC~A~N~~G~~~~s~~L~V~~~p~p~ 51 (98)
..|.|.++..+|+|.|+|.|.|.+|.+.+++.|.|.+.|.||
T Consensus 47 s~L~I~~~~~~D~G~YtC~A~N~~G~~~~~~~L~V~~~P~~P 88 (88)
T cd05735 47 STLQILPTVREDSGFFSCHAINSYGEDRGIIQLTVQEPPDPP 88 (88)
T ss_pred EEEEECCCCcccCEEEEEEEEcCCCcceEEEEEEEeCCCCCC
Confidence 679999999999999999999999999999999999999876
|
Ig8_DSCAM: the eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM). DSCAM is a cell adhesion molecule expressed largely in the developing nervous system. The gene encoding DSCAM is located at human chromosome 21q22, the locus associated with the mental retardation phenotype of Down Syndrome. DSCAM is predicted to be the largest member of the IG superfamily. It has been demonstrated that DSCAM can mediate cation-independent homophilic intercellular adhesion. |
| >cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK) | Back alignment and domain information |
|---|
| >cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2 | Back alignment and domain information |
|---|
| >cd05892 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like domain of myotilin | Back alignment and domain information |
|---|
| >cd05853 Ig6_Contactin-4 Sixth Ig domain of contactin-4 | Back alignment and domain information |
|---|
| >cd04970 Ig6_Contactin_like Sixth Ig domain of contactin | Back alignment and domain information |
|---|
| >cd05893 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like domain of palladin | Back alignment and domain information |
|---|
| >cd05744 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin | Back alignment and domain information |
|---|
| >KOG3513|consensus | Back alignment and domain information |
|---|
| >cd05748 Ig_Titin_like Immunoglobulin (Ig)-like domain of titin and similar proteins | Back alignment and domain information |
|---|
| >cd04974 Ig3_FGFR Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) | Back alignment and domain information |
|---|
| >cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C) | Back alignment and domain information |
|---|
| >cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM) | Back alignment and domain information |
|---|
| >cd05852 Ig5_Contactin-1 Fifth Ig domain of contactin-1 | Back alignment and domain information |
|---|
| >cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) | Back alignment and domain information |
|---|
| >cd05725 Ig3_Robo Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors | Back alignment and domain information |
|---|
| >cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins | Back alignment and domain information |
|---|
| >cd05726 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors | Back alignment and domain information |
|---|
| >cd05858 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2) | Back alignment and domain information |
|---|
| >cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily | Back alignment and domain information |
|---|
| >cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 | Back alignment and domain information |
|---|
| >cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) | Back alignment and domain information |
|---|
| >cd05745 Ig3_Peroxidasin Third immunoglobulin (Ig)-like domain of peroxidasin | Back alignment and domain information |
|---|
| >cd05867 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) | Back alignment and domain information |
|---|
| >cd05765 Ig_3 Subgroup of the immunoglobulin (Ig) superfamily | Back alignment and domain information |
|---|
| >cd04971 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC | Back alignment and domain information |
|---|
| >cd05731 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) | Back alignment and domain information |
|---|
| >cd04969 Ig5_Contactin_like Fifth Ig domain of contactin | Back alignment and domain information |
|---|
| >cd05855 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of Trk receptor TrkB | Back alignment and domain information |
|---|
| >cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor | Back alignment and domain information |
|---|
| >cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related) | Back alignment and domain information |
|---|
| >cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1 | Back alignment and domain information |
|---|
| >cd05723 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins | Back alignment and domain information |
|---|
| >cd05863 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3) | Back alignment and domain information |
|---|
| >cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein | Back alignment and domain information |
|---|
| >cd05746 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like domain of peroxidasin | Back alignment and domain information |
|---|
| >cd04968 Ig3_Contactin_like Third Ig domain of contactin | Back alignment and domain information |
|---|
| >cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins | Back alignment and domain information |
|---|
| >cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) | Back alignment and domain information |
|---|
| >cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1) | Back alignment and domain information |
|---|
| >cd05736 Ig2_Follistatin_like Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins | Back alignment and domain information |
|---|
| >cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin | Back alignment and domain information |
|---|
| >cd05750 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain in neuregulins (NRGs) | Back alignment and domain information |
|---|
| >cd05742 Ig1_VEGFR_like First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor (R) and similar proteins | Back alignment and domain information |
|---|
| >cd05764 Ig_2 Subgroup of the immunoglobulin (Ig) superfamily | Back alignment and domain information |
|---|
| >PF07679 I-set: Immunoglobulin I-set domain; InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds | Back alignment and domain information |
|---|
| >cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha | Back alignment and domain information |
|---|
| >cd05868 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule) | Back alignment and domain information |
|---|
| >cd04976 Ig2_VEGFR Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR) | Back alignment and domain information |
|---|
| >cd05760 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4 | Back alignment and domain information |
|---|
| >cd05864 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2) | Back alignment and domain information |
|---|
| >cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC | Back alignment and domain information |
|---|
| >cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2 | Back alignment and domain information |
|---|
| >cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins | Back alignment and domain information |
|---|
| >cd05895 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1 | Back alignment and domain information |
|---|
| >cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 | Back alignment and domain information |
|---|
| >cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2) | Back alignment and domain information |
|---|
| >cd05734 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM) | Back alignment and domain information |
|---|
| >cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins | Back alignment and domain information |
|---|
| >cd05738 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR | Back alignment and domain information |
|---|
| >cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins | Back alignment and domain information |
|---|
| >cd05862 Ig1_VEGFR First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R) | Back alignment and domain information |
|---|
| >cd04973 Ig1_FGFR First immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) | Back alignment and domain information |
|---|
| >cd05756 Ig1_IL1R_like First immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins | Back alignment and domain information |
|---|
| >cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) | Back alignment and domain information |
|---|
| >cd05861 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b) | Back alignment and domain information |
|---|
| >cd05724 Ig2_Robo Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors | Back alignment and domain information |
|---|
| >cd05739 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR | Back alignment and domain information |
|---|
| >cd05758 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins | Back alignment and domain information |
|---|
| >cd05714 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of chondroitin sulfate proteoglycans (CSPGs), human cartilage link protein (LP) and similar proteins | Back alignment and domain information |
|---|
| >cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins | Back alignment and domain information |
|---|
| >cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins | Back alignment and domain information |
|---|
| >cd05713 Ig_MOG_like Immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG) | Back alignment and domain information |
|---|
| >KOG3513|consensus | Back alignment and domain information |
|---|
| >cd05757 Ig2_IL1R_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins | Back alignment and domain information |
|---|
| >cd05877 Ig_LP_like Immunoglobulin (Ig)-like domain of human cartilage link protein (LP) | Back alignment and domain information |
|---|
| >cd05898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2) | Back alignment and domain information |
|---|
| >cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins | Back alignment and domain information |
|---|
| >cd05886 Ig1_Nectin-1_like First immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins | Back alignment and domain information |
|---|
| >cd05888 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor) and similar proteins | Back alignment and domain information |
|---|
| >cd07701 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) | Back alignment and domain information |
|---|
| >cd05871 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like domain of class III semaphorin | Back alignment and domain information |
|---|
| >cd05771 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain | Back alignment and domain information |
|---|
| >cd05733 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins | Back alignment and domain information |
|---|
| >cd05882 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) | Back alignment and domain information |
|---|
| >cd05848 Ig1_Contactin-5 First Ig domain of contactin-5 | Back alignment and domain information |
|---|
| >cd05900 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan | Back alignment and domain information |
|---|
| >cd05874 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule) | Back alignment and domain information |
|---|
| >cd05878 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG) | Back alignment and domain information |
|---|
| >cd05717 Ig1_Necl-1-3_like First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-3 (also known as cell adhesion molecules CADM3, CADM1, and CADM2 respectively) | Back alignment and domain information |
|---|
| >cd05901 Ig_Versican Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican | Back alignment and domain information |
|---|
| >cd05850 Ig1_Contactin-2 First Ig domain of contactin-2 | Back alignment and domain information |
|---|
| >cd05849 Ig1_Contactin-1 First Ig domain of contactin-1 | Back alignment and domain information |
|---|
| >cd05718 Ig1_PVR_like First immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins | Back alignment and domain information |
|---|
| >cd05722 Ig1_Neogenin First immunoglobulin (Ig)-like domain in neogenin and similar proteins | Back alignment and domain information |
|---|
| >cd05875 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF) | Back alignment and domain information |
|---|
| >cd07702 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1) | Back alignment and domain information |
|---|
| >cd05879 Ig_P0 Immunoglobulin (Ig)-like domain of Protein zero (P0) | Back alignment and domain information |
|---|
| >KOG4194|consensus | Back alignment and domain information |
|---|
| >cd04967 Ig1_Contactin First Ig domain of contactin | Back alignment and domain information |
|---|
| >cd05902 Ig_Neurocan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan | Back alignment and domain information |
|---|
| >cd05887 Ig1_Nectin-3_like First immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and similar proteins | Back alignment and domain information |
|---|
| >smart00410 IG_like Immunoglobulin like | Back alignment and domain information |
|---|
| >smart00409 IG Immunoglobulin | Back alignment and domain information |
|---|
| >smart00408 IGc2 Immunoglobulin C-2 Type | Back alignment and domain information |
|---|
| >cd04979 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of semaphorin | Back alignment and domain information |
|---|
| >cd05897 Ig2_IL1R2_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2) | Back alignment and domain information |
|---|
| >PHA02826 IL-1 receptor-like protein; Provisional | Back alignment and domain information |
|---|
| >cd05880 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithelial V-like antigen 1 (EVA) | Back alignment and domain information |
|---|
| >cd07690 Ig1_CD4 First immunoglobulin (Ig) domain of CD4 | Back alignment and domain information |
|---|
| >cd05715 Ig_P0-like Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins | Back alignment and domain information |
|---|
| >PHA02785 IL-beta-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd05846 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200) and similar proteins | Back alignment and domain information |
|---|
| >cd05753 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins | Back alignment and domain information |
|---|
| >cd05775 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like | Back alignment and domain information |
|---|
| >PHA02785 IL-beta-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs) | Back alignment and domain information |
|---|
| >cd05774 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) | Back alignment and domain information |
|---|
| >cd05727 Ig2_Contactin-2-like Second Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins | Back alignment and domain information |
|---|
| >cd05860 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) | Back alignment and domain information |
|---|
| >KOG4222|consensus | Back alignment and domain information |
|---|
| >cd05752 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins | Back alignment and domain information |
|---|
| >cd04983 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins | Back alignment and domain information |
|---|
| >PF13927 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1VDG_A 1P7Q_D 3D2U_H 1UFU_A 1UGN_A 3VH8_H 3OQ3_B 4DKD_C | Back alignment and domain information |
|---|
| >cd00099 IgV Immunoglobulin variable domain (IgV) | Back alignment and domain information |
|---|
| >cd05873 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4D | Back alignment and domain information |
|---|
| >cd05741 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) and similar proteins | Back alignment and domain information |
|---|
| >cd05896 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1) | Back alignment and domain information |
|---|
| >PF07686 V-set: Immunoglobulin V-set domain; InterPro: IPR013106 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds | Back alignment and domain information |
|---|
| >KOG4221|consensus | Back alignment and domain information |
|---|
| >PF00047 ig: Immunoglobulin domain The Prosite family only concerns antibodies and MHCs | Back alignment and domain information |
|---|
| >cd05889 Ig1_DNAM-1_like First immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226) and similar proteins | Back alignment and domain information |
|---|
| >PF13895 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V5S_B 2GI7_A 3LAF_A 4DEP_C 3O4O_B 2EC8_A 2E9W_A 1J87_A | Back alignment and domain information |
|---|
| >cd05845 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins | Back alignment and domain information |
|---|
| >PHA02633 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd05716 Ig_pIgR Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR) | Back alignment and domain information |
|---|
| >smart00406 IGv Immunoglobulin V-Type | Back alignment and domain information |
|---|
| >cd05712 Ig_Siglec_N Immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins) | Back alignment and domain information |
|---|
| >cd05881 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) | Back alignment and domain information |
|---|
| >PHA02826 IL-1 receptor-like protein; Provisional | Back alignment and domain information |
|---|
| >cd05899 IgV_TCR_beta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain | Back alignment and domain information |
|---|
| >cd05751 Ig1_LILRB1_like First immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1) and similar proteins | Back alignment and domain information |
|---|
| >cd04980 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa type, variable (V) domain | Back alignment and domain information |
|---|
| >cd04984 IgV_L_lambda Immunoglobulin (Ig) lambda light chain variable (V) domain | Back alignment and domain information |
|---|
| >cd00096 Ig Immunoglobulin domain | Back alignment and domain information |
|---|
| >cd04982 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain | Back alignment and domain information |
|---|
| >cd07706 IgV_TCR_delta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain | Back alignment and domain information |
|---|
| >PHA03376 BARF1; Provisional | Back alignment and domain information |
|---|
| >cd07700 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD8 beta chain | Back alignment and domain information |
|---|
| >KOG4222|consensus | Back alignment and domain information |
|---|
| >cd05872 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4B | Back alignment and domain information |
|---|
| >PHA02987 Ig domain OX-2-like protein; Provisional | Back alignment and domain information |
|---|
| >cd05759 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) | Back alignment and domain information |
|---|
| >cd05720 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD8 alpha chain | Back alignment and domain information |
|---|
| >KOG4221|consensus | Back alignment and domain information |
|---|
| >KOG4194|consensus | Back alignment and domain information |
|---|
| >cd05885 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain of nectin-like molecule-4 (Necl-4, also known as cell adhesion molecule 4 (CADM4)) | Back alignment and domain information |
|---|
| >cd04981 IgV_H Immunoglobulin (Ig) heavy chain (H), variable (V) domain | Back alignment and domain information |
|---|
| >cd05711 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of FcalphaRI | Back alignment and domain information |
|---|
| >PF08204 V-set_CD47: CD47 immunoglobulin-like domain; InterPro: IPR013270 This family represents the CD47 leukocyte antigen V-set like Ig domain [, ] | Back alignment and domain information |
|---|
| >cd07694 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4 | Back alignment and domain information |
|---|
| >PF11465 Receptor_2B4: Natural killer cell receptor 2B4; InterPro: IPR024303 2B4 is a transmembrane receptor which is expressed primarily on natural killer (NK) cells | Back alignment and domain information |
|---|
| >cd00098 IgC Immunoglobulin Constant domain | Back alignment and domain information |
|---|
| >cd07691 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain of CD3 gamma and delta chains | Back alignment and domain information |
|---|
| >cd05721 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic T lymphocyte-associated antigen 4 (CTLA-4) | Back alignment and domain information |
|---|
| >KOG4597|consensus | Back alignment and domain information |
|---|
| >PF07354 Sp38: Zona-pellucida-binding protein (Sp38); InterPro: IPR010857 This family contains a number of zona-pellucida-binding proteins that seem to be restricted to mammals | Back alignment and domain information |
|---|
| >PHA03269 envelope glycoprotein C; Provisional | Back alignment and domain information |
|---|
| >PHA02982 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd05761 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-4 (also known as cell adhesion molecules CADM3, CADM1, CADM2, and CADM4, respectively) | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 98 | |||
| 3rbs_A | 207 | Myomesin-1; immunoglobulin C-SET domain, contractI | 3e-09 | |
| 3rbs_A | 207 | Myomesin-1; immunoglobulin C-SET domain, contractI | 7e-09 | |
| 2y23_A | 312 | Myomesin; structural protein, sarcomere, M-BAND, i | 3e-09 | |
| 2y23_A | 312 | Myomesin; structural protein, sarcomere, M-BAND, i | 5e-08 | |
| 2y23_A | 312 | Myomesin; structural protein, sarcomere, M-BAND, i | 3e-05 | |
| 1u2h_A | 99 | APEG-1, aortic preferentially expressed protein 1; | 7e-09 | |
| 1wwc_A | 118 | Protein (NT-3 growth factor receptor TRKC); TRK re | 2e-08 | |
| 3irg_A | 100 | Titin; IG-like, titin, OBSL1, complex, alternative | 2e-08 | |
| 2y25_A | 317 | Myomesin; structural protein, sarcomere, M-BAND, i | 2e-08 | |
| 2y25_A | 317 | Myomesin; structural protein, sarcomere, M-BAND, i | 3e-08 | |
| 2y25_A | 317 | Myomesin; structural protein, sarcomere, M-BAND, i | 6e-06 | |
| 1g1c_A | 99 | Immunoglobulin-like domain I1 from titin; immunogl | 2e-08 | |
| 2kdg_A | 100 | Myotilin; immonoglobulin domain, actin-binding, st | 2e-08 | |
| 2r15_A | 212 | Myomesin-1; sarcomeric protein, IG-like domains, h | 3e-08 | |
| 2r15_A | 212 | Myomesin-1; sarcomeric protein, IG-like domains, h | 8e-06 | |
| 2dm3_A | 110 | KIAA0992 protein, palladin; beta-sandwich, myopall | 4e-08 | |
| 2yr3_A | 99 | Myosin light chain kinase, smooth muscle; IG domai | 4e-08 | |
| 2dm2_A | 110 | Palladin; beta-sandwich, KIAA0992, actin-associate | 5e-08 | |
| 1he7_A | 126 | High affinity nerve growth factor receptor; transf | 6e-08 | |
| 2bk8_A | 97 | Connectin, M1, titin heart isoform N2-B; IG domain | 7e-08 | |
| 2cqv_A | 114 | MLCK, myosin light chain kinase, smooth muscle and | 7e-08 | |
| 3qp3_A | 103 | Titin; I-SET IG-like, sarcomere, M-BAND, transfera | 8e-08 | |
| 1wwb_X | 103 | Protein (brain derived neurotrophic factor recepto | 1e-07 | |
| 3irg_B | 107 | Obscurin-like protein 1; IG-like, titin, OBSL1, co | 2e-07 | |
| 1fhg_A | 154 | Telokin; immunoglobulin fold, beta barrel, contrac | 2e-07 | |
| 3b43_A | 570 | Titin; I-SET IG fold, extended poly-IG filament, e | 2e-07 | |
| 3b43_A | 570 | Titin; I-SET IG fold, extended poly-IG filament, e | 2e-07 | |
| 3b43_A | 570 | Titin; I-SET IG fold, extended poly-IG filament, e | 2e-06 | |
| 3b43_A | 570 | Titin; I-SET IG fold, extended poly-IG filament, e | 3e-06 | |
| 3b43_A | 570 | Titin; I-SET IG fold, extended poly-IG filament, e | 4e-06 | |
| 3b43_A | 570 | Titin; I-SET IG fold, extended poly-IG filament, e | 5e-06 | |
| 2a38_A | 194 | Titin; Z1Z2, structural protein; 2.00A {Homo sapie | 2e-07 | |
| 2a38_A | 194 | Titin; Z1Z2, structural protein; 2.00A {Homo sapie | 6e-07 | |
| 3kvq_A | 108 | Vascular endothelial growth factor receptor 2; veg | 2e-07 | |
| 1wit_A | 93 | Twitchin 18TH IGSF module; immunoglobulin superfam | 2e-07 | |
| 2j8h_A | 197 | Titin, connectin; cardiomyopathy, nuclear protein, | 3e-07 | |
| 2j8h_A | 197 | Titin, connectin; cardiomyopathy, nuclear protein, | 1e-06 | |
| 3puc_A | 99 | Titin; I-SET IG-like domain, M-BAND, transferase; | 3e-07 | |
| 1gxe_A | 139 | Myosin binding protein C, cardiac-type; cytoskelet | 3e-07 | |
| 2kkq_A | 116 | Myotilin; unknown function, actin-binding, cell me | 3e-07 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 4e-07 | |
| 3v2a_R | 772 | Vascular endothelial growth factor receptor 2; IG- | 4e-07 | |
| 3v2a_R | 772 | Vascular endothelial growth factor receptor 2; IG- | 7e-06 | |
| 3v2a_R | 772 | Vascular endothelial growth factor receptor 2; IG- | 8e-06 | |
| 3v2a_R | 772 | Vascular endothelial growth factor receptor 2; IG- | 1e-05 | |
| 3v2a_R | 772 | Vascular endothelial growth factor receptor 2; IG- | 1e-05 | |
| 3v2a_R | 772 | Vascular endothelial growth factor receptor 2; IG- | 1e-05 | |
| 3v2a_R | 772 | Vascular endothelial growth factor receptor 2; IG- | 5e-04 | |
| 1bih_A | 395 | Hemolin; insect immunity, LPS-binding, homophilic | 5e-07 | |
| 1bih_A | 395 | Hemolin; insect immunity, LPS-binding, homophilic | 2e-06 | |
| 1bih_A | 395 | Hemolin; insect immunity, LPS-binding, homophilic | 4e-05 | |
| 2rik_A | 284 | Titin; I-SET IG fold, poly-IG linear array, struct | 6e-07 | |
| 2rik_A | 284 | Titin; I-SET IG fold, poly-IG linear array, struct | 1e-06 | |
| 2rik_A | 284 | Titin; I-SET IG fold, poly-IG linear array, struct | 4e-06 | |
| 3cx2_A | 108 | Myosin-binding protein C, cardiac-type; protonatio | 7e-07 | |
| 2e7c_A | 118 | Myosin-binding protein C, fast-type; IG-like domai | 7e-07 | |
| 3dmk_A | 816 | DOWN syndrome cell adhesion molecule (dscam) ISOF | 7e-07 | |
| 3dmk_A | 816 | DOWN syndrome cell adhesion molecule (dscam) ISOF | 1e-06 | |
| 3dmk_A | 816 | DOWN syndrome cell adhesion molecule (dscam) ISOF | 1e-06 | |
| 3dmk_A | 816 | DOWN syndrome cell adhesion molecule (dscam) ISOF | 3e-06 | |
| 3dmk_A | 816 | DOWN syndrome cell adhesion molecule (dscam) ISOF | 8e-06 | |
| 2dav_A | 126 | SLOW MYBP-C, myosin-binding protein C, SLOW-type; | 1e-06 | |
| 1nct_A | 106 | Titin; cell adhesion, glycoprotein, transmembrane, | 1e-06 | |
| 2wim_A | 291 | N-CAM 2, NCAM2, neural cell adhesion molecule 2; c | 1e-06 | |
| 2wim_A | 291 | N-CAM 2, NCAM2, neural cell adhesion molecule 2; c | 4e-05 | |
| 2wim_A | 291 | N-CAM 2, NCAM2, neural cell adhesion molecule 2; c | 5e-04 | |
| 1ry7_B | 334 | FGFR-3, fibroblast growth factor receptor 3; FGF-F | 1e-06 | |
| 1ry7_B | 334 | FGFR-3, fibroblast growth factor receptor 3; FGF-F | 3e-05 | |
| 1ry7_B | 334 | FGFR-3, fibroblast growth factor receptor 3; FGF-F | 2e-04 | |
| 3caf_A | 100 | Fibroblast growth factor receptor 2; FGFR2, D2, AT | 2e-06 | |
| 1e07_A | 642 | Carcinoembryonic antigen; glycoprotein, CEA, tumou | 2e-06 | |
| 1e07_A | 642 | Carcinoembryonic antigen; glycoprotein, CEA, tumou | 4e-05 | |
| 1e07_A | 642 | Carcinoembryonic antigen; glycoprotein, CEA, tumou | 9e-05 | |
| 1e07_A | 642 | Carcinoembryonic antigen; glycoprotein, CEA, tumou | 1e-04 | |
| 1e07_A | 642 | Carcinoembryonic antigen; glycoprotein, CEA, tumou | 3e-04 | |
| 1e07_A | 642 | Carcinoembryonic antigen; glycoprotein, CEA, tumou | 3e-04 | |
| 1e07_A | 642 | Carcinoembryonic antigen; glycoprotein, CEA, tumou | 8e-04 | |
| 2ens_A | 96 | Advanced glycosylation END product-specific recept | 2e-06 | |
| 3grw_A | 241 | Fibroblast growth factor receptor 3; FGFR3, protei | 2e-06 | |
| 3grw_A | 241 | Fibroblast growth factor receptor 3; FGFR3, protei | 9e-06 | |
| 3laf_A | 403 | Deleted in colorectal cancer; netrin-1 receptor, i | 3e-06 | |
| 3laf_A | 403 | Deleted in colorectal cancer; netrin-1 receptor, i | 2e-05 | |
| 3laf_A | 403 | Deleted in colorectal cancer; netrin-1 receptor, i | 8e-05 | |
| 2eo9_A | 118 | Roundabout homolog 1; beta-sandwich, IG-fold, H-RO | 3e-06 | |
| 2v5t_A | 189 | NCAM2, N-CAM 2, neural cell adhesion molecule 2; p | 3e-06 | |
| 2v5t_A | 189 | NCAM2, N-CAM 2, neural cell adhesion molecule 2; p | 3e-04 | |
| 2nzi_A | 305 | Titin; IG-domain, FNIII-domain, transferase; 2.90A | 4e-06 | |
| 2nzi_A | 305 | Titin; IG-domain, FNIII-domain, transferase; 2.90A | 6e-06 | |
| 2v5m_A | 388 | Dscam; neurobiology SPL immunoglobulin domain, cel | 5e-06 | |
| 2v5m_A | 388 | Dscam; neurobiology SPL immunoglobulin domain, cel | 3e-05 | |
| 3ojm_B | 231 | Fibroblast growth factor receptor 2; beta trefoil | 5e-06 | |
| 3ojm_B | 231 | Fibroblast growth factor receptor 2; beta trefoil | 3e-05 | |
| 3p3y_A | 404 | Neurofascin; IG domains, cell adhesion; HET: NAG; | 6e-06 | |
| 3p3y_A | 404 | Neurofascin; IG domains, cell adhesion; HET: NAG; | 6e-06 | |
| 3p3y_A | 404 | Neurofascin; IG domains, cell adhesion; HET: NAG; | 4e-04 | |
| 1nbq_A | 209 | JAM, junctional adhesion molecule 1, PAM-1; reovir | 7e-06 | |
| 1nbq_A | 209 | JAM, junctional adhesion molecule 1, PAM-1; reovir | 1e-05 | |
| 2va4_A | 192 | NCAM2, N-CAM 2, neural cell adhesion molecule 2; t | 8e-06 | |
| 2va4_A | 192 | NCAM2, N-CAM 2, neural cell adhesion molecule 2; t | 1e-05 | |
| 1f97_A | 212 | Junction adhesion molecule; immunoglobulin superfa | 8e-06 | |
| 1f97_A | 212 | Junction adhesion molecule; immunoglobulin superfa | 1e-05 | |
| 2yd6_A | 212 | PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa | 8e-06 | |
| 2yd6_A | 212 | PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa | 2e-04 | |
| 1cs6_A | 382 | Axonin-1; neural cell adhesion, cell adhesion; 1.8 | 8e-06 | |
| 1cs6_A | 382 | Axonin-1; neural cell adhesion, cell adhesion; 1.8 | 7e-05 | |
| 1cs6_A | 382 | Axonin-1; neural cell adhesion, cell adhesion; 1.8 | 1e-04 | |
| 3qs7_E | 423 | FL cytokine receptor; immunoglobulin-like domain, | 9e-06 | |
| 3qs7_E | 423 | FL cytokine receptor; immunoglobulin-like domain, | 4e-05 | |
| 3qs7_E | 423 | FL cytokine receptor; immunoglobulin-like domain, | 2e-04 | |
| 3lcy_A | 197 | Titin; A-BAND, IG tandem domains, ATP-binding, cal | 1e-05 | |
| 3lcy_A | 197 | Titin; A-BAND, IG tandem domains, ATP-binding, cal | 3e-05 | |
| 1qz1_A | 291 | Neural cell adhesion molecule 1, 140 kDa isoform; | 1e-05 | |
| 1qz1_A | 291 | Neural cell adhesion molecule 1, 140 kDa isoform; | 4e-04 | |
| 3kld_A | 384 | Contactin 4, axcam, BIG-2; cell adhesion, protein | 1e-05 | |
| 3kld_A | 384 | Contactin 4, axcam, BIG-2; cell adhesion, protein | 3e-05 | |
| 3kld_A | 384 | Contactin 4, axcam, BIG-2; cell adhesion, protein | 5e-04 | |
| 2edj_A | 100 | Roundabout homolog 2; KIAA1568 protein, beta sandw | 1e-05 | |
| 2cr3_A | 99 | Basic fibroblast growth factor receptor 1; IG fold | 1e-05 | |
| 4dkd_C | 292 | Macrophage colony-stimulating factor 1 receptor; d | 1e-05 | |
| 4dkd_C | 292 | Macrophage colony-stimulating factor 1 receptor; d | 4e-05 | |
| 2ec8_A | 524 | MAST/stem cell growth factor receptor; glycoprotei | 1e-05 | |
| 2ec8_A | 524 | MAST/stem cell growth factor receptor; glycoprotei | 1e-05 | |
| 2ec8_A | 524 | MAST/stem cell growth factor receptor; glycoprotei | 5e-05 | |
| 3ejj_X | 289 | Macrophage colony-stimulating factor 1 receptor; g | 1e-05 | |
| 3ejj_X | 289 | Macrophage colony-stimulating factor 1 receptor; g | 2e-05 | |
| 3ejj_X | 289 | Macrophage colony-stimulating factor 1 receptor; g | 8e-04 | |
| 2yd1_A | 212 | Tyrosine-protein phosphatase LAR; hydrolase; 1.80A | 1e-05 | |
| 2ckn_A | 95 | Basic fibroblast growth factor receptor 1; kinase, | 2e-05 | |
| 2iep_A | 192 | Muscle-specific kinase receptor; beta-sandwich, si | 2e-05 | |
| 2iep_A | 192 | Muscle-specific kinase receptor; beta-sandwich, si | 2e-05 | |
| 2dlt_A | 106 | Myosin binding protein C, fast-type; IG-like domai | 2e-05 | |
| 3mj6_A | 268 | Junctional adhesion molecule-like; immunoglobulin | 2e-05 | |
| 3mj6_A | 268 | Junctional adhesion molecule-like; immunoglobulin | 4e-05 | |
| 2jll_A | 389 | NCAM2, neural cell adhesion molecule 2; immunoglob | 2e-05 | |
| 2jll_A | 389 | NCAM2, neural cell adhesion molecule 2; immunoglob | 6e-05 | |
| 3bfo_A | 91 | Mucosa-associated lymphoid tissue lymphoma translo | 2e-05 | |
| 3qr2_A | 137 | Basigin; CD147, EMMPRIN, immunoglobulin-like domai | 2e-05 | |
| 2edf_A | 103 | Obscurin; beta-sandwich, IG-fold, structural genom | 3e-05 | |
| 3jz7_A | 214 | MCAR, CAR, coxsackievirus and adenovirus receptor | 3e-05 | |
| 3jz7_A | 214 | MCAR, CAR, coxsackievirus and adenovirus receptor | 8e-05 | |
| 3s97_C | 201 | Contactin-1; carbonic anhdyrase like immunoglobuli | 3e-05 | |
| 3s97_C | 201 | Contactin-1; carbonic anhdyrase like immunoglobuli | 1e-04 | |
| 1rhf_A | 182 | Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 | 3e-05 | |
| 1rhf_A | 182 | Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 | 3e-04 | |
| 2o26_X | 290 | MAST/stem cell growth factor receptor; stem cell f | 3e-05 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 4e-05 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 7e-05 | |
| 2yd9_A | 304 | Receptor-type tyrosine-protein phosphatase S; hydr | 4e-05 | |
| 2yd9_A | 304 | Receptor-type tyrosine-protein phosphatase S; hydr | 2e-04 | |
| 2yd9_A | 304 | Receptor-type tyrosine-protein phosphatase S; hydr | 7e-04 | |
| 3mtr_A | 215 | N-CAM-1, NCAM-1, neural cell adhesion molecule 1; | 4e-05 | |
| 3o4o_C | 339 | Interleukin-1 receptor type 2; cytokine-receptor c | 5e-05 | |
| 3o4o_C | 339 | Interleukin-1 receptor type 2; cytokine-receptor c | 2e-04 | |
| 3k0w_A | 218 | Mucosa-associated lymphoid tissue lymphoma translo | 5e-05 | |
| 3k0w_A | 218 | Mucosa-associated lymphoid tissue lymphoma translo | 8e-05 | |
| 2c5d_C | 195 | AXL oncogene, tyrosine-protein kinase receptor UFO | 5e-05 | |
| 1gl4_B | 98 | Basement membrane-specific heparan sulfate proteog | 6e-05 | |
| 2v44_A | 189 | NCAM2, neural cell adhesion molecule 2; phosphoryl | 6e-05 | |
| 2v44_A | 189 | NCAM2, neural cell adhesion molecule 2; phosphoryl | 1e-04 | |
| 3qs9_E | 527 | FL cytokine receptor; immunoglobulin-like domain, | 6e-05 | |
| 3qs9_E | 527 | FL cytokine receptor; immunoglobulin-like domain, | 7e-05 | |
| 3qs9_E | 527 | FL cytokine receptor; immunoglobulin-like domain, | 1e-04 | |
| 3qs9_E | 527 | FL cytokine receptor; immunoglobulin-like domain, | 5e-04 | |
| 2x1w_L | 213 | Vascular endothelial growth factor receptor 2; hor | 7e-05 | |
| 2vr9_A | 217 | Roundabout 1, ROBO; immunoglobulin-like domain, AX | 7e-05 | |
| 2vr9_A | 217 | Roundabout 1, ROBO; immunoglobulin-like domain, AX | 8e-05 | |
| 2v9r_A | 212 | Roundabout homolog 1; proto-oncogene, differentiat | 8e-05 | |
| 2ocw_A | 585 | Polymeric-immunoglobulin receptor; SC, secretory, | 1e-04 | |
| 2ocw_A | 585 | Polymeric-immunoglobulin receptor; SC, secretory, | 4e-04 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 1e-04 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 2e-04 | |
| 1epf_A | 191 | NCAM, protein (neural cell adhesion molecule); imm | 2e-04 | |
| 1epf_A | 191 | NCAM, protein (neural cell adhesion molecule); imm | 2e-04 | |
| 2e6p_A | 104 | Obscurin-like protein 1; IG-like domain, structura | 2e-04 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 2e-04 | |
| 2dm7_A | 108 | KIAA1556 protein; beta-sandwich, IG-fold, obscurin | 3e-04 | |
| 3s35_X | 122 | Vascular endothelial growth factor receptor 2; ant | 3e-04 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 3e-04 | |
| 3mjg_X | 289 | Beta-type platelet-derived growth factor receptor; | 3e-04 | |
| 2ch8_A | 201 | BARF1, P33, 33 kDa early protein; viral protein, i | 3e-04 | |
| 2ch8_A | 201 | BARF1, P33, 33 kDa early protein; viral protein, i | 8e-04 | |
| 2fbo_J | 250 | V1V2;, variable region-containing chitin-binding p | 3e-04 | |
| 2eny_A | 104 | Obscurin; beta-sandwich, IG-fold, structural genom | 4e-04 | |
| 1pd6_A | 104 | Cardiac MYBP-C;, myosin-binding protein C, cardiac | 6e-04 | |
| 1itb_B | 315 | Type 1 interleukin-1 receptor; immunoglobulin fold | 6e-04 | |
| 2yuz_A | 100 | Myosin-binding protein C, SLOW-type; immunoglobuli | 6e-04 | |
| 2jtd_A | 142 | Myomesin-1, skelemin; immunoglobulin domain, muscl | 7e-04 | |
| 3r4d_A | 208 | CEA-related cell adhesion molecule 1, isoform 1/2; | 7e-04 | |
| 2v9t_A | 117 | Roundabout homolog 1; structural protein-receptor | 8e-04 | |
| 1x44_A | 103 | Myosin-binding protein C, SLOW-type; IG-like domai | 9e-04 |
| >3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 | Back alignment and structure |
|---|
Score = 50.7 bits (121), Expect = 3e-09
Identities = 15/89 (16%), Positives = 32/89 (35%)
Query: 1 MSYDPQSGNVGLVIDSIGPGDEGEYTCCARNEFGEAICAVFIQPECVNVPLYQQRMQQMQ 60
M D +G + + ++ + DEG YT ++ V + + + Q+ +
Sbjct: 52 MHIDRNTGIIEMFMEKLQDEDEGTYTFQLQDGKATNHSTVVLVGDVFKKLQKEAEFQRQE 111
Query: 61 QHRSEKTAYSNGSQSIVSEYSGAILVMKV 89
R + + V+ +L KV
Sbjct: 112 WIRKQGPHFVEYLSWEVTGECNVLLKCKV 140
|
| >3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 | Back alignment and structure |
|---|
| >2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 | Back alignment and structure |
|---|
| >2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 | Back alignment and structure |
|---|
| >2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 | Back alignment and structure |
|---|
| >1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Length = 118 | Back alignment and structure |
|---|
| >2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Length = 99 | Back alignment and structure |
|---|
| >2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 | Back alignment and structure |
|---|
| >2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 | Back alignment and structure |
|---|
| >2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Length = 126 | Back alignment and structure |
|---|
| >2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 114 | Back alignment and structure |
|---|
| >3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Length = 103 | Back alignment and structure |
|---|
| >1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Length = 154 | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 | Back alignment and structure |
|---|
| >2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 | Back alignment and structure |
|---|
| >2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 | Back alignment and structure |
|---|
| >3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Length = 93 | Back alignment and structure |
|---|
| >2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 | Back alignment and structure |
|---|
| >2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 | Back alignment and structure |
|---|
| >3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 | Back alignment and structure |
|---|
| >1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 | Back alignment and structure |
|---|
| >1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 | Back alignment and structure |
|---|
| >1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 | Back alignment and structure |
|---|
| >2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 | Back alignment and structure |
|---|
| >2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 | Back alignment and structure |
|---|
| >2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 | Back alignment and structure |
|---|
| >3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Length = 108 | Back alignment and structure |
|---|
| >2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 | Back alignment and structure |
|---|
| >2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 126 | Back alignment and structure |
|---|
| >1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Length = 106 | Back alignment and structure |
|---|
| >2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 | Back alignment and structure |
|---|
| >2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 | Back alignment and structure |
|---|
| >2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 | Back alignment and structure |
|---|
| >1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 | Back alignment and structure |
|---|
| >1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 | Back alignment and structure |
|---|
| >1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 | Back alignment and structure |
|---|
| >3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Length = 100 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 | Back alignment and structure |
|---|
| >2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 | Back alignment and structure |
|---|
| >3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 | Back alignment and structure |
|---|
| >3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 | Back alignment and structure |
|---|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 | Back alignment and structure |
|---|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 | Back alignment and structure |
|---|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 | Back alignment and structure |
|---|
| >2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 | Back alignment and structure |
|---|
| >2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 | Back alignment and structure |
|---|
| >2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 | Back alignment and structure |
|---|
| >2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 | Back alignment and structure |
|---|
| >3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 | Back alignment and structure |
|---|
| >3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 | Back alignment and structure |
|---|
| >3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 | Back alignment and structure |
|---|
| >3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 | Back alignment and structure |
|---|
| >3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 | Back alignment and structure |
|---|
| >1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 | Back alignment and structure |
|---|
| >1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 | Back alignment and structure |
|---|
| >1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 | Back alignment and structure |
|---|
| >1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 | Back alignment and structure |
|---|
| >2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 | Back alignment and structure |
|---|
| >2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 | Back alignment and structure |
|---|
| >1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 | Back alignment and structure |
|---|
| >1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 | Back alignment and structure |
|---|
| >1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 | Back alignment and structure |
|---|
| >3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 | Back alignment and structure |
|---|
| >3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 | Back alignment and structure |
|---|
| >3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 | Back alignment and structure |
|---|
| >3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 | Back alignment and structure |
|---|
| >3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 | Back alignment and structure |
|---|
| >1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 | Back alignment and structure |
|---|
| >1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 | Back alignment and structure |
|---|
| >3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 | Back alignment and structure |
|---|
| >3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 | Back alignment and structure |
|---|
| >3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 | Back alignment and structure |
|---|
| >2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 | Back alignment and structure |
|---|
| >4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 | Back alignment and structure |
|---|
| >2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 | Back alignment and structure |
|---|
| >2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 | Back alignment and structure |
|---|
| >2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 | Back alignment and structure |
|---|
| >3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 | Back alignment and structure |
|---|
| >3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 | Back alignment and structure |
|---|
| >3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 | Back alignment and structure |
|---|
| >2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Length = 212 | Back alignment and structure |
|---|
| >2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Length = 95 | Back alignment and structure |
|---|
| >2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 | Back alignment and structure |
|---|
| >2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 | Back alignment and structure |
|---|
| >2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Length = 106 | Back alignment and structure |
|---|
| >3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Length = 268 | Back alignment and structure |
|---|
| >3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Length = 268 | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 | Back alignment and structure |
|---|
| >3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A Length = 137 | Back alignment and structure |
|---|
| >2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Length = 214 | Back alignment and structure |
|---|
| >3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Length = 214 | Back alignment and structure |
|---|
| >3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 | Back alignment and structure |
|---|
| >1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 | Back alignment and structure |
|---|
| >2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 | Back alignment and structure |
|---|
| >2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 | Back alignment and structure |
|---|
| >2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 | Back alignment and structure |
|---|
| >3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 | Back alignment and structure |
|---|
| >3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 | Back alignment and structure |
|---|
| >3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 | Back alignment and structure |
|---|
| >3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 | Back alignment and structure |
|---|
| >3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 | Back alignment and structure |
|---|
| >2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Length = 195 | Back alignment and structure |
|---|
| >1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Length = 98 | Back alignment and structure |
|---|
| >3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 | Back alignment and structure |
|---|
| >3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 | Back alignment and structure |
|---|
| >3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 | Back alignment and structure |
|---|
| >3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 | Back alignment and structure |
|---|
| >2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Length = 213 | Back alignment and structure |
|---|
| >2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 | Back alignment and structure |
|---|
| >2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 | Back alignment and structure |
|---|
| >2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 | Back alignment and structure |
|---|
| >2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Length = 585 | Back alignment and structure |
|---|
| >2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Length = 585 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 | Back alignment and structure |
|---|
| >1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 | Back alignment and structure |
|---|
| >2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A Length = 108 | Back alignment and structure |
|---|
| >3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X Length = 122 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 | Back alignment and structure |
|---|
| >2ch8_A BARF1, P33, 33 kDa early protein; viral protein, immunoglobulin domain, oncogene; HET: NAG MAN; 2.3A {Epstein-barr virus} Length = 201 | Back alignment and structure |
|---|
| >2ch8_A BARF1, P33, 33 kDa early protein; viral protein, immunoglobulin domain, oncogene; HET: NAG MAN; 2.3A {Epstein-barr virus} Length = 201 | Back alignment and structure |
|---|
| >2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Length = 250 | Back alignment and structure |
|---|
| >2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >1pd6_A Cardiac MYBP-C;, myosin-binding protein C, cardiac-type, domain C2; IG domain, structural protein; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 104 | Back alignment and structure |
|---|
| >1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 | Back alignment and structure |
|---|
| >2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2jtd_A Myomesin-1, skelemin; immunoglobulin domain, muscle protein, thick filament, immune system, cell adhesion; NMR {Mus musculus} Length = 142 | Back alignment and structure |
|---|
| >3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Length = 208 | Back alignment and structure |
|---|
| >2v9t_A Roundabout homolog 1; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} Length = 117 | Back alignment and structure |
|---|
| >1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 103 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 98 | |||
| 3knb_B | 107 | Obscurin-like protein 1; IG-like, titin, OBSL1, AT | 99.0 | |
| 3knb_A | 100 | Titin; IG-like, titin, OBSL1, ATP-binding, calmodu | 99.0 | |
| 3mtr_A | 215 | N-CAM-1, NCAM-1, neural cell adhesion molecule 1; | 99.0 | |
| 2cqv_A | 114 | MLCK, myosin light chain kinase, smooth muscle and | 98.99 | |
| 1wwb_X | 103 | Protein (brain derived neurotrophic factor recepto | 98.93 | |
| 2nzi_A | 305 | Titin; IG-domain, FNIII-domain, transferase; 2.90A | 98.92 | |
| 2dm2_A | 110 | Palladin; beta-sandwich, KIAA0992, actin-associate | 98.88 | |
| 2e7c_A | 118 | Myosin-binding protein C, fast-type; IG-like domai | 98.87 | |
| 2dm3_A | 110 | KIAA0992 protein, palladin; beta-sandwich, myopall | 98.86 | |
| 2jll_A | 389 | NCAM2, neural cell adhesion molecule 2; immunoglob | 98.82 | |
| 3cx2_A | 108 | Myosin-binding protein C, cardiac-type; protonatio | 98.82 | |
| 2kkq_A | 116 | Myotilin; unknown function, actin-binding, cell me | 98.81 | |
| 2dav_A | 126 | SLOW MYBP-C, myosin-binding protein C, SLOW-type; | 98.8 | |
| 3s35_X | 122 | Vascular endothelial growth factor receptor 2; ant | 98.79 | |
| 1g1c_A | 99 | Immunoglobulin-like domain I1 from titin; immunogl | 98.78 | |
| 1wit_A | 93 | Twitchin 18TH IGSF module; immunoglobulin superfam | 98.78 | |
| 2kdg_A | 100 | Myotilin; immonoglobulin domain, actin-binding, st | 98.78 | |
| 3qp3_A | 103 | Titin; I-SET IG-like, sarcomere, M-BAND, transfera | 98.78 | |
| 1gxe_A | 139 | Myosin binding protein C, cardiac-type; cytoskelet | 98.78 | |
| 1u2h_A | 99 | APEG-1, aortic preferentially expressed protein 1; | 98.77 | |
| 3kvq_A | 108 | Vascular endothelial growth factor receptor 2; veg | 98.77 | |
| 1he7_A | 126 | High affinity nerve growth factor receptor; transf | 98.76 | |
| 3irg_B | 107 | Obscurin-like protein 1; IG-like, titin, OBSL1, co | 98.75 | |
| 3m45_A | 108 | Cell adhesion molecule 2; IG fold, dimer, disulfid | 98.75 | |
| 2bk8_A | 97 | Connectin, M1, titin heart isoform N2-B; IG domain | 98.72 | |
| 2edn_A | 118 | Myosin-binding protein C, fast-type; beta-sandwich | 98.71 | |
| 3irg_A | 100 | Titin; IG-like, titin, OBSL1, complex, alternative | 98.71 | |
| 2yuz_A | 100 | Myosin-binding protein C, SLOW-type; immunoglobuli | 98.7 | |
| 3puc_A | 99 | Titin; I-SET IG-like domain, M-BAND, transferase; | 98.7 | |
| 1z9m_A | 145 | GAPA225; nectin-like, IG-like domain, V domain, ce | 98.69 | |
| 2yr3_A | 99 | Myosin light chain kinase, smooth muscle; IG domai | 98.69 | |
| 1wwc_A | 118 | Protein (NT-3 growth factor receptor TRKC); TRK re | 98.68 | |
| 1fhg_A | 154 | Telokin; immunoglobulin fold, beta barrel, contrac | 98.65 | |
| 2edj_A | 100 | Roundabout homolog 2; KIAA1568 protein, beta sandw | 98.65 | |
| 3rbs_A | 207 | Myomesin-1; immunoglobulin C-SET domain, contractI | 98.63 | |
| 3rbg_A | 124 | Cytotoxic and regulatory T-cell molecule; IGV, crt | 98.61 | |
| 2eo9_A | 118 | Roundabout homolog 1; beta-sandwich, IG-fold, H-RO | 98.61 | |
| 1gl4_B | 98 | Basement membrane-specific heparan sulfate proteog | 98.61 | |
| 4hwu_A | 95 | Fibroblast growth factor receptor 2; FGFR2, KGFR, | 98.6 | |
| 2cr3_A | 99 | Basic fibroblast growth factor receptor 1; IG fold | 98.6 | |
| 1nct_A | 106 | Titin; cell adhesion, glycoprotein, transmembrane, | 98.59 | |
| 2e6p_A | 104 | Obscurin-like protein 1; IG-like domain, structura | 98.55 | |
| 1x44_A | 103 | Myosin-binding protein C, SLOW-type; IG-like domai | 98.55 | |
| 3caf_A | 100 | Fibroblast growth factor receptor 2; FGFR2, D2, AT | 98.55 | |
| 2x1w_L | 213 | Vascular endothelial growth factor receptor 2; hor | 98.53 | |
| 3grw_A | 241 | Fibroblast growth factor receptor 3; FGFR3, protei | 98.53 | |
| 2edf_A | 103 | Obscurin; beta-sandwich, IG-fold, structural genom | 98.52 | |
| 3ojm_B | 231 | Fibroblast growth factor receptor 2; beta trefoil | 98.51 | |
| 4fqp_A | 313 | Poliovirus receptor; immunoglobulin-like domain, I | 98.5 | |
| 2ckn_A | 95 | Basic fibroblast growth factor receptor 1; kinase, | 98.49 | |
| 2d9q_B | 313 | Granulocyte colony-stimulating factor receptor; cy | 98.48 | |
| 4fa8_A | 203 | Secreted protein BARF1; immunoglobulin-like domain | 98.48 | |
| 3mjg_X | 289 | Beta-type platelet-derived growth factor receptor; | 98.48 | |
| 1pko_A | 139 | Myelin oligodendrocyte glycoprotein; IGV-domain, i | 98.48 | |
| 2cry_A | 122 | KIN of IRRE-like protein 3; IG fold, KIN of irregu | 98.46 | |
| 4fom_A | 308 | Poliovirus receptor-related protein 3; immunoglobu | 98.46 | |
| 4gos_A | 125 | V-SET domain-containing T-cell activation inhibit; | 98.45 | |
| 3udw_C | 118 | Poliovirus receptor; PVR tigit IGSF signal transdu | 98.45 | |
| 1waa_A | 93 | Titin; metal binding protein, calmodulin-binding, | 98.44 | |
| 3jz7_A | 214 | MCAR, CAR, coxsackievirus and adenovirus receptor | 98.43 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 98.43 | |
| 2eny_A | 104 | Obscurin; beta-sandwich, IG-fold, structural genom | 98.43 | |
| 2o26_X | 290 | MAST/stem cell growth factor receptor; stem cell f | 98.42 | |
| 3b5h_A | 184 | Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce | 98.41 | |
| 2cpc_A | 113 | KIAA0657 protein; immunoglobulin domain, IG domain | 98.4 | |
| 1eaj_A | 126 | Coxsackie virus and adenovirus receptor; virus/vir | 98.4 | |
| 2y23_A | 312 | Myomesin; structural protein, sarcomere, M-BAND, i | 98.39 | |
| 2va4_A | 192 | NCAM2, N-CAM 2, neural cell adhesion molecule 2; t | 98.39 | |
| 3so5_A | 112 | LIG-3, leucine-rich repeats and immunoglobulin-lik | 98.38 | |
| 1ry7_B | 334 | FGFR-3, fibroblast growth factor receptor 3; FGF-F | 98.38 | |
| 2v5y_A | 731 | Receptor-type tyrosine-protein phosphatase MU; mem | 98.38 | |
| 2lu7_A | 84 | Obscurin-like protein 1; structural genomics, nort | 98.37 | |
| 2dku_A | 103 | KIAA1556 protein; beta-sandwich, IG-fold, obscurin | 98.37 | |
| 3jz7_A | 214 | MCAR, CAR, coxsackievirus and adenovirus receptor | 98.37 | |
| 2wim_A | 291 | N-CAM 2, NCAM2, neural cell adhesion molecule 2; c | 98.37 | |
| 2wv3_A | 190 | Neuroplastin; igcam, membrane, glycoprotein, cell | 98.37 | |
| 3bp6_B | 202 | Programmed cell death 1 ligand 2; PD-1, PD-L2, com | 98.36 | |
| 2ny1_B | 184 | T-cell surface glycoprotein CD4; HIV, GP120, CD4, | 98.36 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 98.36 | |
| 2yuv_A | 100 | Myosin-binding protein C, SLOW-type; SLOW-type myo | 98.35 | |
| 2dlt_A | 106 | Myosin binding protein C, fast-type; IG-like domai | 98.34 | |
| 2or8_A | 116 | Hepatitis A virus cellular receptor 1 homolog; bet | 98.34 | |
| 2edk_A | 101 | Myosin-binding protein C, fast-type; IG fold, fast | 98.34 | |
| 2edh_A | 113 | Obscurin; structural genomics, NPPSFA, national pr | 98.33 | |
| 1zox_A | 113 | CLM-1; IG-superfamily, IG-V, NKP44-like, myeloid I | 98.33 | |
| 2j8h_A | 197 | Titin, connectin; cardiomyopathy, nuclear protein, | 98.33 | |
| 2r15_A | 212 | Myomesin-1; sarcomeric protein, IG-like domains, h | 98.32 | |
| 3ejj_X | 289 | Macrophage colony-stimulating factor 1 receptor; g | 98.31 | |
| 4dkd_C | 292 | Macrophage colony-stimulating factor 1 receptor; d | 98.3 | |
| 2jll_A | 389 | NCAM2, neural cell adhesion molecule 2; immunoglob | 98.29 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 98.29 | |
| 2y25_A | 317 | Myomesin; structural protein, sarcomere, M-BAND, i | 98.28 | |
| 2k1m_A | 95 | Myosin-binding protein C, cardiac-type; IG-I domai | 98.28 | |
| 3rrq_A | 129 | Protein PD-1, programmed cell death protein 1; pro | 98.28 | |
| 3sbw_C | 222 | Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- | 98.27 | |
| 1i1r_A | 303 | GP130, interleukin-6 receptor beta chain; cytokine | 98.27 | |
| 3bfo_A | 91 | Mucosa-associated lymphoid tissue lymphoma translo | 98.27 | |
| 3q0h_A | 117 | T cell immunoreceptor with IG and ITIM domains; im | 98.27 | |
| 2a38_A | 194 | Titin; Z1Z2, structural protein; 2.00A {Homo sapie | 98.26 | |
| 4f80_A | 226 | Butyrophilin subfamily 3 member A1; B7 superfamily | 98.26 | |
| 2rik_A | 284 | Titin; I-SET IG fold, poly-IG linear array, struct | 98.26 | |
| 1neu_A | 124 | Myelin P0 protein; structural protein, glycoprotei | 98.26 | |
| 1qz1_A | 291 | Neural cell adhesion molecule 1, 140 kDa isoform; | 98.25 | |
| 2a38_A | 194 | Titin; Z1Z2, structural protein; 2.00A {Homo sapie | 98.25 | |
| 2oyp_A | 109 | Hepatitis A virus cellular receptor 2; TIM-3, T-ce | 98.24 | |
| 3b43_A | 570 | Titin; I-SET IG fold, extended poly-IG filament, e | 98.23 | |
| 1vca_A | 202 | VCAM-D1,2, human vascular cell adhesion molecule-1 | 98.23 | |
| 2or7_A | 115 | T-cell immunoglobulin and mucin domain- containing | 98.23 | |
| 2j8h_A | 197 | Titin, connectin; cardiomyopathy, nuclear protein, | 98.23 | |
| 3s97_C | 201 | Contactin-1; carbonic anhdyrase like immunoglobuli | 98.22 | |
| 3khq_A | 133 | B-cell antigen receptor complex-associated protei | 98.2 | |
| 2dm7_A | 108 | KIAA1556 protein; beta-sandwich, IG-fold, obscurin | 98.2 | |
| 4gjt_B | 123 | Poliovirus receptor-related protein 4; six-bladed | 98.2 | |
| 2v5t_A | 189 | NCAM2, N-CAM 2, neural cell adhesion molecule 2; p | 98.18 | |
| 3mj6_A | 268 | Junctional adhesion molecule-like; immunoglobulin | 98.18 | |
| 1f97_A | 212 | Junction adhesion molecule; immunoglobulin superfa | 98.18 | |
| 4i0k_A | 222 | CD276 antigen; immunoglobulin domain, glycoprotein | 98.18 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 98.18 | |
| 4f80_A | 226 | Butyrophilin subfamily 3 member A1; B7 superfamily | 98.18 | |
| 3kld_A | 384 | Contactin 4, axcam, BIG-2; cell adhesion, protein | 98.17 | |
| 3lcy_A | 197 | Titin; A-BAND, IG tandem domains, ATP-binding, cal | 98.17 | |
| 3lcy_A | 197 | Titin; A-BAND, IG tandem domains, ATP-binding, cal | 98.17 | |
| 2lvc_A | 91 | Obscurin-like protein 1; structural genomics, nort | 98.17 | |
| 1hng_A | 176 | CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra | 98.17 | |
| 2v44_A | 189 | NCAM2, neural cell adhesion molecule 2; phosphoryl | 98.15 | |
| 3laf_A | 403 | Deleted in colorectal cancer; netrin-1 receptor, i | 98.14 | |
| 3rbs_A | 207 | Myomesin-1; immunoglobulin C-SET domain, contractI | 98.13 | |
| 3b43_A | 570 | Titin; I-SET IG fold, extended poly-IG filament, e | 98.13 | |
| 2wv3_A | 190 | Neuroplastin; igcam, membrane, glycoprotein, cell | 98.13 | |
| 3qr2_A | 137 | Basigin; CD147, EMMPRIN, immunoglobulin-like domai | 98.13 | |
| 3pv7_A | 248 | B7-H6, IG-like domain-containing protein DKFZP686O | 98.12 | |
| 2nzi_A | 305 | Titin; IG-domain, FNIII-domain, transferase; 2.90A | 98.12 | |
| 1dr9_A | 201 | B7-1 (CD80), T lymphocyte activation antigen; IG s | 98.11 | |
| 1itb_B | 315 | Type 1 interleukin-1 receptor; immunoglobulin fold | 98.11 | |
| 2qsq_A | 111 | Carcinoembryonic antigen-related cell adhesion MO; | 98.1 | |
| 2rik_A | 284 | Titin; I-SET IG fold, poly-IG linear array, struct | 98.1 | |
| 3bp6_B | 202 | Programmed cell death 1 ligand 2; PD-1, PD-L2, com | 98.1 | |
| 3kld_A | 384 | Contactin 4, axcam, BIG-2; cell adhesion, protein | 98.1 | |
| 2yd1_A | 212 | Tyrosine-protein phosphatase LAR; hydrolase; 1.80A | 98.09 | |
| 3p3y_A | 404 | Neurofascin; IG domains, cell adhesion; HET: NAG; | 98.09 | |
| 2yd1_A | 212 | Tyrosine-protein phosphatase LAR; hydrolase; 1.80A | 98.08 | |
| 1xt5_A | 135 | Variable region-containing chitin-binding protein | 98.08 | |
| 2v9r_A | 212 | Roundabout homolog 1; proto-oncogene, differentiat | 98.08 | |
| 3p2t_A | 196 | Leukocyte immunoglobulin-like receptor subfamily 4 | 98.07 | |
| 2e7b_A | 103 | Obscurin; IG-like domain, structural genomics, NPP | 98.07 | |
| 3sgj_C | 204 | Human FCG3A receptor; receptor complex, FC recepto | 98.07 | |
| 1cs6_A | 382 | Axonin-1; neural cell adhesion, cell adhesion; 1.8 | 98.07 | |
| 2ocw_A | 585 | Polymeric-immunoglobulin receptor; SC, secretory, | 98.07 | |
| 3mj8_L | 213 | Stimulatory hamster antibody HL4E10 FAB light CHA; | 98.06 | |
| 1n26_A | 325 | IL-6 receptor alpha chain; transmembrane, glycopro | 98.06 | |
| 2fbo_J | 250 | V1V2;, variable region-containing chitin-binding p | 98.06 | |
| 2nms_A | 124 | CMRF35-like-molecule 1; IG-superfamily, IG-V, NKP4 | 98.06 | |
| 3u83_A | 331 | Poliovirus receptor-related protein 1; nectin-1, h | 98.05 | |
| 2eo1_A | 102 | OBSCN protein, cDNA FLJ14124 FIS, clone mamma10024 | 98.05 | |
| 3nl4_L | 213 | Antigen binding fragment, immunoglobulin IGG - LI; | 98.04 | |
| 2if7_A | 193 | SLAM family member 6; NTB-A, homophilic receptor, | 98.04 | |
| 2v5m_A | 388 | Dscam; neurobiology SPL immunoglobulin domain, cel | 98.04 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 98.04 | |
| 1ccz_A | 171 | Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.8 | 98.04 | |
| 1bih_A | 395 | Hemolin; insect immunity, LPS-binding, homophilic | 98.04 | |
| 1pd6_A | 104 | Cardiac MYBP-C;, myosin-binding protein C, cardiac | 98.03 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 98.03 | |
| 4fa8_A | 203 | Secreted protein BARF1; immunoglobulin-like domain | 98.03 | |
| 2ens_A | 96 | Advanced glycosylation END product-specific recept | 98.03 | |
| 2q87_A | 110 | CMRF35-H antigen; all-beta, immunoglobulin, IG-sup | 98.02 | |
| 1gsm_A | 210 | Madcam-1, mucosal addressin cell adhesion molecule | 98.02 | |
| 4frw_A | 218 | Poliovirus receptor-related protein 4; immunoglobu | 98.01 | |
| 3ojm_B | 231 | Fibroblast growth factor receptor 2; beta trefoil | 98.01 | |
| 2fbo_J | 250 | V1V2;, variable region-containing chitin-binding p | 98.01 | |
| 2iep_A | 192 | Muscle-specific kinase receptor; beta-sandwich, si | 98.0 | |
| 1epf_A | 191 | NCAM, protein (neural cell adhesion molecule); imm | 98.0 | |
| 3s96_B | 218 | 3B5H10 FAB light chain; huntingtin, immune system; | 98.0 | |
| 3v2a_R | 772 | Vascular endothelial growth factor receptor 2; IG- | 98.0 | |
| 2ec8_A | 524 | MAST/stem cell growth factor receptor; glycoprotei | 98.0 | |
| 3qs7_E | 423 | FL cytokine receptor; immunoglobulin-like domain, | 97.99 | |
| 1f2q_A | 176 | High affinity immunoglobulin epsilon receptor ALP | 97.99 | |
| 1nbq_A | 209 | JAM, junctional adhesion molecule 1, PAM-1; reovir | 97.99 | |
| 2cr6_A | 115 | KIAA1556 protein, obscurin; IG-fold, immunoglobuli | 97.98 | |
| 2va4_A | 192 | NCAM2, N-CAM 2, neural cell adhesion molecule 2; t | 97.98 | |
| 2yd6_A | 212 | PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa | 97.98 | |
| 2xzc_L | 216 | FAB A.17 light chain; immune system; HET: XOP; 1.3 | 97.97 | |
| 1jbj_A | 186 | CD3 epsilon and gamma ectodomain fragment complex; | 97.97 | |
| 2ocw_A | 585 | Polymeric-immunoglobulin receptor; SC, secretory, | 97.97 | |
| 3tv3_L | 211 | PGT128 light chain, IG lambda-2 chain C regions; F | 97.97 | |
| 4dkd_C | 292 | Macrophage colony-stimulating factor 1 receptor; d | 97.96 | |
| 3ejj_X | 289 | Macrophage colony-stimulating factor 1 receptor; g | 97.96 | |
| 1f97_A | 212 | Junction adhesion molecule; immunoglobulin superfa | 97.96 | |
| 2yd9_A | 304 | Receptor-type tyrosine-protein phosphatase S; hydr | 97.95 | |
| 3d9a_L | 213 | Light chain of hyhel10 antibody fragment (FAB); ly | 97.95 | |
| 2e6q_A | 112 | Obscurin-like protein 1; IG-like domain, structura | 97.94 | |
| 2r15_A | 212 | Myomesin-1; sarcomeric protein, IG-like domains, h | 97.94 | |
| 2pet_A | 231 | Lutheran blood group glycoprotein; immunoglobulin | 97.94 | |
| 2yd6_A | 212 | PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa | 97.94 | |
| 2v5m_A | 388 | Dscam; neurobiology SPL immunoglobulin domain, cel | 97.93 | |
| 3bia_X | 116 | T-cell immunoglobulin and mucin domain- containing | 97.92 | |
| 3eow_R | 221 | Poliovirus receptor; immunoglobulin super family, | 97.92 | |
| 2ptt_A | 110 | CD48 antigen; CD244, CD48, NK cell receptor, X-RAY | 97.92 | |
| 3mj6_A | 268 | Junctional adhesion molecule-like; immunoglobulin | 97.91 | |
| 3oq3_B | 329 | IFN-alpha/beta binding protein C12R; mousepox viru | 97.91 | |
| 1wio_A | 363 | CD4, T-cell surface glycoprotein CD4; immunoglobul | 97.91 | |
| 1ugn_A | 198 | LIR1, leukocyte immunoglobulin-like receptor 1; im | 97.91 | |
| 1hnf_A | 182 | CD2; T lymphocyte adhesion glycoprotein; HET: NAG; | 97.91 | |
| 3r0n_A | 128 | Poliovirus receptor-related protein 2; IG-domain, | 97.9 | |
| 2d3v_A | 196 | Leukocyte immunoglobulin-like receptor subfamily A | 97.9 | |
| 4fmk_A | 225 | Poliovirus receptor-related protein 2; immunoglobu | 97.9 | |
| 1lk3_L | 210 | 9D7 light chain; antigen-antibody complex, immune | 97.9 | |
| 2vr9_A | 217 | Roundabout 1, ROBO; immunoglobulin-like domain, AX | 97.9 | |
| 1ugn_A | 198 | LIR1, leukocyte immunoglobulin-like receptor 1; im | 97.89 | |
| 3qs9_E | 527 | FL cytokine receptor; immunoglobulin-like domain, | 97.89 | |
| 4fmk_A | 225 | Poliovirus receptor-related protein 2; immunoglobu | 97.89 | |
| 4fom_A | 308 | Poliovirus receptor-related protein 3; immunoglobu | 97.89 | |
| 3r06_A | 213 | Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; | 97.88 | |
| 3k0w_A | 218 | Mucosa-associated lymphoid tissue lymphoma translo | 97.88 | |
| 2ec8_A | 524 | MAST/stem cell growth factor receptor; glycoprotei | 97.88 | |
| 2d9c_A | 136 | Signal-regulatory protein beta-1; beta-sandwich, S | 97.87 | |
| 2c5d_C | 195 | AXL oncogene, tyrosine-protein kinase receptor UFO | 97.87 | |
| 3p3y_A | 404 | Neurofascin; IG domains, cell adhesion; HET: NAG; | 97.87 | |
| 2zg1_A | 214 | Sialic acid-binding IG-like lectin 5; siglec-5 inh | 97.86 | |
| 3r4d_A | 208 | CEA-related cell adhesion molecule 1, isoform 1/2; | 97.86 | |
| 3p2t_A | 196 | Leukocyte immunoglobulin-like receptor subfamily 4 | 97.86 | |
| 1rhf_A | 182 | Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 | 97.86 | |
| 2dru_A | 180 | Chimera of CD48 antigen and T-cell surface antige; | 97.86 | |
| 3r4d_A | 208 | CEA-related cell adhesion molecule 1, isoform 1/2; | 97.85 | |
| 2yd9_A | 304 | Receptor-type tyrosine-protein phosphatase S; hydr | 97.85 | |
| 2gi7_A | 184 | GPVI protein; IG-like domains, blood clotting, cel | 97.85 | |
| 2c5d_C | 195 | AXL oncogene, tyrosine-protein kinase receptor UFO | 97.84 | |
| 2h32_A | 126 | Immunoglobulin IOTA chain; beta sheets, V and C-ty | 97.83 | |
| 4dep_C | 349 | Interleukin-1 receptor accessory protein; B-trefoi | 97.82 | |
| 3ry4_A | 170 | Low affinity immunoglobulin gamma FC region recep; | 97.82 | |
| 2wim_A | 291 | N-CAM 2, NCAM2, neural cell adhesion molecule 2; c | 97.82 | |
| 1za6_B | 344 | IGG heavy chain; immunoglobulin fold, CH2-domain-d | 97.82 | |
| 1ry7_B | 334 | FGFR-3, fibroblast growth factor receptor 3; FGF-F | 97.82 | |
| 1f3r_B | 257 | FV antibody fragment; IG-fold, immuno complex, ant | 97.82 | |
| 3grw_A | 241 | Fibroblast growth factor receptor 3; FGFR3, protei | 97.82 | |
| 2v44_A | 189 | NCAM2, neural cell adhesion molecule 2; phosphoryl | 97.82 | |
| 3sob_L | 237 | Antibody light chain; beta propeller, protein bind | 97.81 | |
| 3mjg_X | 289 | Beta-type platelet-derived growth factor receptor; | 97.81 | |
| 1moe_A | 240 | Anti-CEA MAB T84.66; anti carcinoembryonic antigen | 97.81 | |
| 1op3_H | 225 | FAB 2G12, heavy chain; domain-swapped FAB 2G12, an | 97.81 | |
| 1h5b_A | 113 | Murine T cell receptor (TCR) valpha domain; immune | 97.81 | |
| 2ghw_B | 247 | Anti-SARS SCFV antibody, 80R; S protein, neutraliz | 97.8 | |
| 2y25_A | 317 | Myomesin; structural protein, sarcomere, M-BAND, i | 97.8 | |
| 4dep_C | 349 | Interleukin-1 receptor accessory protein; B-trefoi | 97.8 | |
| 1q9r_B | 222 | S25-2 FAB (IGG1K) heavy chain; antigen-binding fra | 97.79 | |
| 1oll_A | 188 | NK receptor; immune system/receptor, NK cell trigg | 97.79 | |
| 1qz1_A | 291 | Neural cell adhesion molecule 1, 140 kDa isoform; | 97.79 | |
| 2edo_A | 121 | CD48 antigen; beta-sandwich, IG-fold, B-lymphocyte | 97.78 | |
| 1fnl_A | 175 | Low affinity immunoglobulin gamma FC region recept | 97.78 | |
| 3rjd_A | 262 | High affinity immunoglobulin gamma FC receptor I; | 97.77 | |
| 1ncn_A | 110 | T lymphocyte activation antigen CD86; IG V, beta s | 97.76 | |
| 1jhl_L | 108 | IGG1-kappa D11.15 FV (light chain); complex(antibo | 97.76 | |
| 1nko_A | 132 | Sialic acid binding IG-like lectin 7; immunoglobul | 97.75 | |
| 2v9t_A | 117 | Roundabout homolog 1; structural protein-receptor | 97.75 | |
| 1rhf_A | 182 | Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 | 97.75 | |
| 3juy_B | 256 | 3B3 single chain variant HIV-1 antibody; envelope | 97.75 | |
| 1bih_A | 395 | Hemolin; insect immunity, LPS-binding, homophilic | 97.75 | |
| 1e07_A | 642 | Carcinoembryonic antigen; glycoprotein, CEA, tumou | 97.74 | |
| 1dee_B | 223 | IGM RF 2A2; FAB-IBP complex 2.7A resolution bindin | 97.74 | |
| 1qok_A | 282 | MFE-23 recombinant antibody fragment; immunoglobul | 97.74 | |
| 1nqb_A | 256 | Single-chain antibody fragment; multivalent antibo | 97.74 | |
| 3o3u_N | 581 | Maltose-binding periplasmic protein, advanced Gly | 97.74 | |
| 1q0x_L | 212 | FAB 9B1, light chain; anti-morphine antibody, FAB | 97.73 | |
| 1cs6_A | 382 | Axonin-1; neural cell adhesion, cell adhesion; 1.8 | 97.73 | |
| 3omz_A | 259 | Human vdelta1 gamma delta T cell receptor delta1A; | 97.73 | |
| 3nl4_H | 215 | Antigen binding fragment,immunoglobulin IGG - HEA; | 97.73 | |
| 3vh8_G | 316 | Killer cell immunoglobulin-like receptor 3DL1; imm | 97.73 | |
| 2wng_A | 327 | Tyrosine-protein phosphatase non-receptor type sub | 97.73 | |
| 1c1e_H | 219 | Catalytic antibody 1E9 (heavy chain); diels-alder, | 97.72 | |
| 3d9a_H | 210 | Heavy chain of hyhel10 antibody fragment (FAB); ly | 97.72 | |
| 2iep_A | 192 | Muscle-specific kinase receptor; beta-sandwich, si | 97.72 | |
| 2jjs_C | 127 | Leukocyte surface antigen CD47; signal regulatory | 97.71 | |
| 1nbq_A | 209 | JAM, junctional adhesion molecule 1, PAM-1; reovir | 97.71 | |
| 3sbw_C | 222 | Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- | 97.71 | |
| 1sy6_A | 204 | T-cell surface glycoprotein CD3 gamma/epsilon chai | 97.7 | |
| 3o4o_C | 339 | Interleukin-1 receptor type 2; cytokine-receptor c | 97.7 | |
| 3qs7_E | 423 | FL cytokine receptor; immunoglobulin-like domain, | 97.7 | |
| 2fbj_H | 220 | IGA-kappa J539 FAB (heavy chain); immunoglobulin; | 97.7 | |
| 1jbj_A | 186 | CD3 epsilon and gamma ectodomain fragment complex; | 97.69 | |
| 3laf_A | 403 | Deleted in colorectal cancer; netrin-1 receptor, i | 97.69 | |
| 1qgc_4 | 438 | Protein (immunoglobulin); virus-antibody complex, | 97.68 | |
| 2o26_X | 290 | MAST/stem cell growth factor receptor; stem cell f | 97.68 | |
| 3bae_H | 228 | WO2 IGG2A FAB fragment heavy chain; abeta, FAB, WO | 97.68 | |
| 2j6e_L | 234 | IGM, FAB light chain; autoimmune complex human IGM | 97.68 | |
| 3gkz_A | 257 | Anti-methamphetamine single chain FV; therapeutic | 97.67 | |
| 3rjd_A | 262 | High affinity immunoglobulin gamma FC receptor I; | 97.67 | |
| 3o4o_C | 339 | Interleukin-1 receptor type 2; cytokine-receptor c | 97.67 | |
| 3dmk_A | 816 | DOWN syndrome cell adhesion molecule (dscam) ISOF | 97.66 | |
| 1uct_A | 218 | Immunoglobulin alpha FC receptor; beta stands, imm | 97.66 | |
| 1pz5_B | 220 | Heavy chain of FAB (SYA/J6); antibody-antigen stru | 97.66 | |
| 1epf_A | 191 | NCAM, protein (neural cell adhesion molecule); imm | 97.66 | |
| 3bkj_L | 252 | WO2 IGG2A FAB fragment light chain kappa; abeta, F | 97.66 | |
| 3m8o_H | 221 | Immunoglobulin A1 heavy chain; immunoglobulin fold | 97.66 | |
| 2c1o_A | 254 | IGK-C protein; FAB fragment, enantioselective, fin | 97.65 | |
| 2oz4_A | 265 | Intercellular adhesion molecule 1; IGSF domain, st | 97.65 | |
| 3dmk_A | 816 | DOWN syndrome cell adhesion molecule (dscam) ISOF | 97.64 | |
| 3uzq_A | 253 | Anti-dengue MAB 4E11; dengue antibody neutralizati | 97.64 | |
| 1svz_A | 247 | Immunoglobulin;, single-chain FV fragment 1696; an | 97.64 | |
| 4fqp_A | 313 | Poliovirus receptor; immunoglobulin-like domain, I | 97.64 | |
| 3nfj_J | 245 | T cell receptor beta chain; immunoglobulin family, | 97.63 | |
| 3tf7_C | 256 | 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; | 97.63 | |
| 3pl6_D | 268 | MBP peptide / T-cell receptor beta chain chimera; | 97.63 | |
| 1hng_A | 176 | CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra | 97.63 | |
| 4i0k_A | 222 | CD276 antigen; immunoglobulin domain, glycoprotein | 97.62 | |
| 1c5d_H | 215 | Monoclonal antibody against the main immunogenic t | 97.62 | |
| 3uzq_A | 253 | Anti-dengue MAB 4E11; dengue antibody neutralizati | 97.61 | |
| 3u83_A | 331 | Poliovirus receptor-related protein 1; nectin-1, h | 97.6 | |
| 3ux9_B | 256 | SCFV antibody; five helices, long loop connecting | 97.6 | |
| 3umt_A | 256 | SCFV heavy chain and light chain; stability engine | 97.6 | |
| 2ny1_B | 184 | T-cell surface glycoprotein CD4; HIV, GP120, CD4, | 97.59 | |
| 3kg5_A | 134 | B-cell antigen receptor complex-associated protei | 97.59 | |
| 3liz_H | 253 | 4C3 monoclonal antibody heavy chain; hydrolase-imm | 97.59 | |
| 3oq3_B | 329 | IFN-alpha/beta binding protein C12R; mousepox viru | 97.58 | |
| 4dzb_B | 246 | Vbeta2 (MAIT T cell receptor); immune system; 1.70 | 97.57 | |
| 1nkr_A | 201 | P58-CL42 KIR; inhibitory receptor, natural killer | 97.57 | |
| 3bik_B | 134 | Programmed cell death protein 1; CO-stimulation, r | 97.57 | |
| 2ywz_A | 111 | NEW antigen receptor variable domain; IG VNAR, imm | 97.56 | |
| 2p1y_A | 238 | Bispecific alpha/beta TCR; autoimmunity, immunoglo | 97.55 | |
| 3k0w_A | 218 | Mucosa-associated lymphoid tissue lymphoma translo | 97.55 | |
| 2rcj_C | 523 | Light chain; immunoglobulin M, polymeric antibodie | 97.54 | |
| 3bn9_D | 257 | E2 FAB heavy chain; antibody-protease complex, pro | 97.54 | |
| 2znx_A | 242 | SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, s | 97.54 | |
| 2y23_A | 312 | Myomesin; structural protein, sarcomere, M-BAND, i | 97.53 | |
| 3auv_A | 276 | SC-DSFV derived from the G6-FAB; SC-DSFV (disulfid | 97.53 | |
| 1hzh_H | 457 | IGG, immunoglobulin heavy chain; antibody, immune | 97.53 | |
| 1qgc_4 | 438 | Protein (immunoglobulin); virus-antibody complex, | 97.52 | |
| 1e07_A | 642 | Carcinoembryonic antigen; glycoprotein, CEA, tumou | 97.52 | |
| 3bqu_C | 233 | 3H6 FAB light chain; beta sheet, immune system; 3. | 97.52 | |
| 2p1y_A | 238 | Bispecific alpha/beta TCR; autoimmunity, immunoglo | 97.52 | |
| 2coq_A | 108 | NEW antigen receptor variable domain; IG VNAR, nat | 97.51 | |
| 1pew_A | 109 | JTO2, A lambda-6 type immunoglobulin light chain, | 97.51 | |
| 4hwn_A | 108 | FC receptor-like A; FCRLA, FCRL, IG-C2 domain, IG | 97.51 | |
| 1mqk_L | 120 | Antibody 7E2 FV fragment, light chain; membrane pr | 97.5 | |
| 1qfw_M | 108 | FV, antibody (anti beta subunit) (light chain); gl | 97.5 | |
| 4frw_A | 218 | Poliovirus receptor-related protein 4; immunoglobu | 97.5 | |
| 3d85_D | 306 | IL-12B, interleukin-12 subunit P40, cytotoxic lymp | 97.5 | |
| 1oll_A | 188 | NK receptor; immune system/receptor, NK cell trigg | 97.5 | |
| 1mju_H | 227 | Immunoglobulin MS6-12; catalytic antibody, ester h | 97.49 | |
| 3bp6_A | 117 | Programmed cell death protein 1; PD-1, PD-L2, comp | 97.49 | |
| 3tf7_C | 256 | 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; | 97.46 | |
| 3qs9_E | 527 | FL cytokine receptor; immunoglobulin-like domain, | 97.46 | |
| 3esu_F | 250 | Antibody 14B7* light chain and antibody 14B7* heav | 97.46 | |
| 1z7z_I | 450 | Intercellular adhesion molecule-1; ICAM-1,kilifi,C | 97.45 | |
| 2xqy_G | 261 | A13-D6.3 monoclonal antibody, envelope glycoprotei | 97.45 | |
| 3qhz_H | 232 | Human monoclonal antibody DEL2D1, FAB heavy chain; | 97.45 | |
| 1tvd_A | 116 | T cell receptor, ES204 V delta; immunoreceptor, TC | 97.43 | |
| 1dn0_B | 232 | IGM-kappa cold agglutinin (heavy chain); FAB, anti | 97.43 | |
| 1nfd_E | 212 | H57 FAB; complex (immunoreceptor-immunoglobulin), | 97.43 | |
| 1igt_B | 444 | IGG2A intact antibody - MAB231; intact immunoglobu | 97.43 | |
| 2ghw_B | 247 | Anti-SARS SCFV antibody, 80R; S protein, neutraliz | 97.42 | |
| 1uct_A | 218 | Immunoglobulin alpha FC receptor; beta stands, imm | 97.41 | |
| 1dlf_H | 124 | Anti-dansyl immunoglobulin IGG2A(S); FV fragment; | 97.41 | |
| 1xed_A | 117 | Polymeric-immunoglobulin receptor; IG-like fold, i | 97.4 | |
| 1wio_A | 363 | CD4, T-cell surface glycoprotein CD4; immunoglobul | 97.4 | |
| 2d3v_A | 196 | Leukocyte immunoglobulin-like receptor subfamily A | 97.39 | |
| 3gkz_A | 257 | Anti-methamphetamine single chain FV; therapeutic | 97.39 | |
| 4ei6_B | 245 | Vbeta16 XV19 type II natural killer T cell recept | 97.39 | |
| 1u9k_A | 114 | Triggering receptor expressed on myeloid cells 1; | 97.39 | |
| 1iga_A | 475 | IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg | 97.39 | |
| 3sgj_C | 204 | Human FCG3A receptor; receptor complex, FC recepto | 97.38 | |
| 4ffy_L | 126 | DENV1-E111 single chain variable fragment (light; | 97.37 | |
| 2pnd_A | 119 | V-SET and immunoglobulin domain containing 4; comp | 97.37 | |
| 2jju_A | 127 | Signal regulatory protein beta-1; immunoglobulin d | 97.37 | |
| 3f8u_B | 401 | Tapasin; endoplasmic reticulum, glycoprotein, immu | 97.37 | |
| 1sq2_N | 113 | Novel antigen receptor; immunoglobulin fold, prote | 97.37 | |
| 2q20_A | 109 | VK1 O18/O8 germline light chain variable domain; A | 97.36 | |
| 3v2a_R | 772 | Vascular endothelial growth factor receptor 2; IG- | 97.36 | |
| 1i8k_A | 107 | Epidermal growth factor receptor antibody MR1SCFV | 97.36 | |
| 1j05_L | 111 | T84.66 antibody, anti-CEA MAB T84.66, light chain; | 97.36 | |
| 3oai_A | 507 | Maltose-binding periplasmic protein, myelin prote; | 97.35 | |
| 2vsd_A | 105 | CHIR AB1; immune system receptor, FC receptor; HET | 97.35 | |
| 3umt_A | 256 | SCFV heavy chain and light chain; stability engine | 97.35 | |
| 2v5t_A | 189 | NCAM2, N-CAM 2, neural cell adhesion molecule 2; p | 97.35 | |
| 3fku_X | 280 | Neutralizing antibody F10; influenza, hemagglutini | 97.34 | |
| 1oaq_L | 120 | Light chain; antibody, allergy, IGE, conformationa | 97.34 | |
| 1p6f_A | 242 | NKP46, natural cytotoxicity triggering receptor 1; | 97.34 | |
| 2gjj_A | 264 | A21 single-chain antibody fragment against ERBB2; | 97.33 | |
| 3n9g_H | 230 | FAB fragment of MAB CR4354, heavy chain; human neu | 97.33 | |
| 1xau_A | 122 | B- and T-lymphocyte attenuator; IG domain, beta sa | 97.33 | |
| 2x1w_L | 213 | Vascular endothelial growth factor receptor 2; hor | 97.32 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 97.32 | |
| 1f3r_B | 257 | FV antibody fragment; IG-fold, immuno complex, ant | 97.32 | |
| 1bec_A | 238 | 14.3.D T cell antigen receptor; T cell receptor; 1 | 97.31 | |
| 3pv7_A | 248 | B7-H6, IG-like domain-containing protein DKFZP686O | 97.31 | |
| 2yc1_A | 117 | Single chain antibody fragment 9004G; immune syste | 97.31 | |
| 1hkf_A | 122 | NKP44, NK cell activating receptor; natural cytoto | 97.31 | |
| 1ypz_E | 207 | T cell receptor delta, beta-2-microglobulin; H2-T2 | 97.31 | |
| 2zg1_A | 214 | Sialic acid-binding IG-like lectin 5; siglec-5 inh | 97.3 | |
| 2q7n_A | 488 | Leukemia inhibitory factor receptor; cytokine cell | 97.3 | |
| 1x9q_A | 268 | SCFV, 4M5.3 anti-fluorescein single chain antibody | 97.3 | |
| 1fo0_A | 116 | Protein (BM3.3 T cell receptor alpha-chain); class | 97.29 | |
| 2e27_L | 119 | Anti-ciguatoxin antibody, light chain; immunoglobu | 97.29 | |
| 2pkd_A | 111 | SLAM family member 5; signaling lymphocyte activat | 97.29 | |
| 1jtp_A | 148 | Single-domain antibody; immunoglobulin, heavy chai | 97.29 | |
| 1sjv_A | 114 | R9; camelids antibody, domain swapping, heavy chai | 97.29 | |
| 1a2y_B | 116 | IGG1-kappa D1.3 FV (heavy chain); complex (immunog | 97.28 | |
| 1mfa_H | 120 | IGG1-lambda Se155-4 FAB (heavy chain); immunoglobu | 97.28 | |
| 2v9r_A | 212 | Roundabout homolog 1; proto-oncogene, differentiat | 97.27 | |
| 1p6f_A | 242 | NKP46, natural cytotoxicity triggering receptor 1; | 97.27 | |
| 3qib_D | 270 | 2B4 beta chain; IG domain, immune system; HET: NAG | 97.26 | |
| 1f2q_A | 176 | High affinity immunoglobulin epsilon receptor ALP | 97.26 | |
| 3auv_A | 276 | SC-DSFV derived from the G6-FAB; SC-DSFV (disulfid | 97.26 | |
| 1kxv_C | 121 | Camelid VHH domain CAB10; beta 8 alpha 8, beta bar | 97.26 | |
| 1u3h_A | 110 | T-cell receptor alpha-chain; complex, immune syste | 96.35 | |
| 3u6r_L | 143 | Antibody 1:7 (light chain); IG-like domain, neutra | 97.25 | |
| 1b6u_A | 257 | KIR2DL3, P58 killer cell inhibitory receptor; natu | 97.25 | |
| 3fku_X | 280 | Neutralizing antibody F10; influenza, hemagglutini | 97.25 | |
| 1n4x_H | 120 | Immunoglobulin heavy chain variable region; immune | 97.24 | |
| 1j05_H | 121 | T84.66 antibody, anti-CEA MAB T84.66, heavy chain; | 97.24 | |
| 2rcj_C | 523 | Light chain; immunoglobulin M, polymeric antibodie | 97.24 | |
| 2wbj_D | 279 | OB TCR; transmembrane, immune response, T cell rec | 97.23 | |
| 1fnl_A | 175 | Low affinity immunoglobulin gamma FC region recept | 97.22 | |
| 2gi7_A | 184 | GPVI protein; IG-like domains, blood clotting, cel | 97.22 | |
| 1eeq_A | 114 | Kappa-4 immunoglobulin (light chain); protein stab | 97.22 | |
| 3b9v_A | 120 | Heavy chain variable domain; antibody engineering, | 97.22 | |
| 2znx_A | 242 | SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, s | 97.22 | |
| 1vca_A | 202 | VCAM-D1,2, human vascular cell adhesion molecule-1 | 97.21 | |
| 3q5y_A | 240 | TCR N15 beta; IG, T cell receptor, antigen peptide | 97.21 | |
| 2vr9_A | 217 | Roundabout 1, ROBO; immunoglobulin-like domain, AX | 97.21 | |
| 3cx5_J | 127 | Heavy chain (VH) of FV-fragment; complex III, elec | 97.21 | |
| 3sob_H | 256 | Antibody heavy chain, low-density lipoprotein rece | 97.2 | |
| 3bdb_A | 137 | Novel immune-type receptor 11; immunoglobulin vari | 97.19 | |
| 3moq_A | 126 | NEW antigen receptor variable domain, P3(40) PEPT | 97.19 | |
| 3bj9_1 | 116 | Immunoglobulin IOTA chain, immunoglobulin lambda- | 97.18 | |
| 2qhl_A | 111 | Novel immune-type receptor 10; immunoglobulin vari | 97.18 | |
| 1mju_H | 227 | Immunoglobulin MS6-12; catalytic antibody, ester h | 97.18 | |
| 1igy_B | 434 | IGG1 intact antibody MAB61.1.3; intact immunoglobu | 97.16 | |
| 2wng_A | 327 | Tyrosine-protein phosphatase non-receptor type sub | 97.16 | |
| 1i3g_L | 111 | Antibody FV fragment; antibiotic; 2.44A {Mus muscu | 97.15 | |
| 1dlf_L | 113 | Anti-dansyl immunoglobulin IGG2A(S); FV fragment; | 97.15 | |
| 2p45_B | 123 | Antibody CAB-RN05; seMet phasing, camelid single-d | 97.15 | |
| 3ux9_B | 256 | SCFV antibody; five helices, long loop connecting | 97.15 | |
| 1oga_E | 252 | TRBC1, T-cell receptor beta chain C region; immune | 97.14 | |
| 1iga_A | 475 | IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg | 97.14 | |
| 3u2s_H | 248 | PG9 heavy chain; greek KEY, immunoglobulin, immune | 97.12 | |
| 1yc7_A | 124 | Anti-VSG immunoglobulin heavy chain variable domai | 97.12 | |
| 1svz_A | 247 | Immunoglobulin;, single-chain FV fragment 1696; an | 97.11 | |
| 2yz1_A | 120 | Tyrosine-protein phosphatase non-receptor type sub | 97.11 | |
| 3tv3_H | 239 | PGT128 heavy chain, IG gamma-1 chain C region; FAB | 97.1 | |
| 3mlr_H | 226 | Human monoclonal anti-HIV-1 GP120 V3 antibody 255 | 97.09 | |
| 1z7z_I | 450 | Intercellular adhesion molecule-1; ICAM-1,kilifi,C | 97.09 | |
| 2wzp_D | 123 | Camelid VHH5; baseplate, viral protein; 2.60A {Lam | 97.09 | |
| 1kxt_B | 127 | Immunoglobulin VHH fragment; alpha 8 beta 8, beta | 97.08 | |
| 1i3u_A | 127 | Antibody VHH LAMA domain; VHH fragment, immune sys | 97.08 | |
| 1qfo_A | 119 | Protein (sialoadhesin); immunoglobulin superfamily | 97.08 | |
| 1xiw_D | 122 | Immunoglobulin heavy chain variable region; CD3-ep | 97.08 | |
| 2atp_B | 115 | T-cell surface glycoprotein CD8 beta chain; CD8AB, | 97.07 | |
| 1hxm_B | 242 | Gamma-delta T-cell receptor; IG domain, TCR, GDTCR | 97.07 | |
| 3eow_R | 221 | Poliovirus receptor; immunoglobulin super family, | 97.07 | |
| 1ypz_F | 230 | T-cell receptor gamma chain, beta-2-microglobulin; | 97.06 | |
| 1zvh_A | 134 | Immunoglobulin heavy chain antibody variable domai | 97.06 | |
| 2z35_A | 112 | T-cell receptor alpha-chain; immune receptor, immu | 97.05 | |
| 3d9a_L | 213 | Light chain of hyhel10 antibody fragment (FAB); ly | 97.05 | |
| 1hxm_A | 229 | Gamma-delta T-cell receptor; IG domain, TCR, GDTCR | 97.04 | |
| 2frg_P | 106 | TREM-like transcript-1; immunoglobulin-like, beta- | 97.04 | |
| 2x1q_A | 127 | Gelsolin nanobody; contractIle protein; 1.06A {Lam | 97.04 | |
| 1smo_A | 119 | Triggering receptor expressed on myeloid cells 1; | 97.04 | |
| 2xt1_B | 121 | Camelid VHH 9; viral protein-immune system complex | 97.04 | |
| 2bnu_A | 203 | TCR alpha chain, T-cell receptor alpha chain C reg | 97.03 | |
| 3vh8_G | 316 | Killer cell immunoglobulin-like receptor 3DL1; imm | 97.03 | |
| 2gjj_A | 264 | A21 single-chain antibody fragment against ERBB2; | 97.02 | |
| 2otu_A | 115 | FV light chain variable domain; antibody FV polygl | 97.02 | |
| 3iu4_H | 263 | CHP3 FAB heavy chain; antibody, ganglioside, idiot | 96.99 | |
| 1mqk_H | 127 | Antibody 7E2 FV fragment, heavy chain; membrane pr | 96.99 | |
| 1dr9_A | 201 | B7-1 (CD80), T lymphocyte activation antigen; IG s | 96.99 | |
| 2aw2_A | 120 | B and T lymphocyte attenuator; IGI domain, IGG dom | 96.98 | |
| 1itb_B | 315 | Type 1 interleukin-1 receptor; immunoglobulin fold | 96.98 | |
| 2gki_A | 291 | Nuclease; anti-DNA antibody, catalytic antibody, i | 96.98 | |
| 1q9r_B | 222 | S25-2 FAB (IGG1K) heavy chain; antigen-binding fra | 96.98 | |
| 3esu_F | 250 | Antibody 14B7* light chain and antibody 14B7* heav | 96.97 | |
| 2vol_A | 207 | Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, | 96.95 | |
| 2oz4_A | 265 | Intercellular adhesion molecule 1; IGSF domain, st | 96.94 | |
| 3mtr_A | 215 | N-CAM-1, NCAM-1, neural cell adhesion molecule 1; | 96.93 | |
| 2oi9_C | 121 | V beta, T cell receptor beta chain; TCR, MHC, immu | 96.93 | |
| 2ol3_A | 142 | BM3.3 T-cell receptor alpha-chain; T cell receptor | 96.92 | |
| 3noi_A | 120 | Natural cytotoxicity triggering receptor 3; immune | 96.92 | |
| 3mj8_L | 213 | Stimulatory hamster antibody HL4E10 FAB light CHA; | 96.89 | |
| 3k1k_C | 123 | Enhancer; nanobody, antibody-complex, chromophore, | 96.89 | |
| 1qok_A | 282 | MFE-23 recombinant antibody fragment; immunoglobul | 96.88 | |
| 2i24_N | 121 | NEW antigen receptor PBLA8; immunoglobulin fold, i | 96.88 | |
| 2ak4_D | 211 | SB27 T cell receptor alpha chain; bulged epitopes, | 96.87 | |
| 3s97_C | 201 | Contactin-1; carbonic anhdyrase like immunoglobuli | 96.87 | |
| 1rjc_A | 137 | 1D2L19, camelid heavy chain antibody; beta sandwic | 96.87 | |
| 1zvy_A | 136 | Immunoglobulin heavy chain antibody variable DOMA; | 96.87 | |
| 3juy_B | 256 | 3B3 single chain variant HIV-1 antibody; envelope | 96.87 | |
| 1nqb_A | 256 | Single-chain antibody fragment; multivalent antibo | 96.86 | |
| 1kgc_D | 206 | T-cell receptor alpha chain; LC13 clone, immune sy | 96.86 | |
| 2gki_A | 291 | Nuclease; anti-DNA antibody, catalytic antibody, i | 96.85 | |
| 3k74_B | 115 | Nanobody; immunoglobulin, antibiotic resista metho | 96.85 | |
| 3nn8_A | 122 | Engineered SCFV, heavy chain; beta barrel, antibod | 96.84 | |
| 3lh2_H | 137 | FV 4E10 heavy chain; epitope-scaffold, immune syst | 96.83 | |
| 2hp4_A | 114 | T-cell surface glycoprotein CD8 alpha chain; CO-re | 96.83 | |
| 1oga_D | 215 | T-cell receptor alpha chain V region, beta-2-micro | 96.81 | |
| 2d7t_H | 139 | Anti polyhydroxybutyrate antibody FV, heavy chain; | 96.8 | |
| 1dn0_B | 232 | IGM-kappa cold agglutinin (heavy chain); FAB, anti | 96.78 | |
| 1moe_A | 240 | Anti-CEA MAB T84.66; anti carcinoembryonic antigen | 96.77 | |
| 2yc1_B | 146 | Single chain antibody fragment 9004G; immune syste | 96.74 | |
| 1lk3_L | 210 | 9D7 light chain; antigen-antibody complex, immune | 96.74 | |
| 3iy0_H | 120 | FAB 14, heavy domain; cryoem, neutralizing antibod | 96.74 | |
| 3omz_A | 259 | Human vdelta1 gamma delta T cell receptor delta1A; | 96.73 | |
| 2if7_A | 193 | SLAM family member 6; NTB-A, homophilic receptor, | 96.73 |
| >3knb_B Obscurin-like protein 1; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 2wp3_O* 2wwm_C 2wwk_O | Back alignment and structure |
|---|
Probab=99.00 E-value=4.3e-10 Score=70.92 Aligned_cols=42 Identities=33% Similarity=0.460 Sum_probs=37.6
Q ss_pred CCeEEEEEcCCCCCCCeeEEEEEeCCCCceEEEEEEEEeecC
Q psy2158 7 SGNVGLVIDSIGPGDEGEYTCCARNEFGEAICAVFIQPECVN 48 (98)
Q Consensus 7 ~g~~~L~I~~v~~~D~G~YtC~A~N~~G~~~~s~~L~V~~~p 48 (98)
.+.+.|.|.++..+|+|.|+|.|.|.+|.+.+++.|.|.++|
T Consensus 66 ~~~~~L~I~~v~~~D~G~Y~C~a~N~~G~~~~~~~l~V~~pP 107 (107)
T 3knb_B 66 GAEHGLLLTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPP 107 (107)
T ss_dssp TTEEEEEESSCCGGGCEEEEEEEEETTEEEEEEEEEEEEC--
T ss_pred CceEEEEEecCChhhCEEEEEEEEECCCEEEEEEEEEEEcCC
Confidence 467789999999999999999999999999999999998754
|
| >3knb_A Titin; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 3q5o_A 2wp3_T* 2wwk_T 2wwm_D 2y9r_T* | Back alignment and structure |
|---|
| >3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 | Back alignment and structure |
|---|
| >1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A | Back alignment and structure |
|---|
| >3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A | Back alignment and structure |
|---|
| >2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 | Back alignment and structure |
|---|
| >3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X | Back alignment and structure |
|---|
| >1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 | Back alignment and structure |
|---|
| >1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A | Back alignment and structure |
|---|
| >2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} | Back alignment and structure |
|---|
| >3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} SCOP: b.1.1.0 | Back alignment and structure |
|---|
| >1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X | Back alignment and structure |
|---|
| >3m45_A Cell adhesion molecule 2; IG fold, dimer, disulfide bond, glycoprotein, immunoglobulin membrane, transmembrane; HET: NAG; 2.21A {Mus musculus} | Back alignment and structure |
|---|
| >2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} | Back alignment and structure |
|---|
| >2edn_A Myosin-binding protein C, fast-type; beta-sandwich, IG-fold, fast MYBP-C, C-protein, skeletal muscle fast isoform, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} | Back alignment and structure |
|---|
| >1z9m_A GAPA225; nectin-like, IG-like domain, V domain, cell adhesion; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 | Back alignment and structure |
|---|
| >1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A | Back alignment and structure |
|---|
| >2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3rbg_A Cytotoxic and regulatory T-cell molecule; IGV, crtam, structural genomics, PSI-biology, NEW YORK struc genomics research consortium, nysgrc; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 | Back alignment and structure |
|---|
| >4hwu_A Fibroblast growth factor receptor 2; FGFR2, KGFR, CD332, IG-C2 type 1 domain, IG superfamily, IMM system, structural genomics, PSI-biology; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A | Back alignment and structure |
|---|
| >2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 | Back alignment and structure |
|---|
| >3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A | Back alignment and structure |
|---|
| >2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* | Back alignment and structure |
|---|
| >3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C | Back alignment and structure |
|---|
| >4fqp_A Poliovirus receptor; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA FUC MAN; 3.60A {Homo sapiens} PDB: 1nn8_R 1dgi_R | Back alignment and structure |
|---|
| >2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >4fa8_A Secreted protein BARF1; immunoglobulin-like domains, 4-helix bundle fold, viral PROT cytokine complex; HET: NAG BMA; 2.20A {Human herpesvirus 4} PDB: 2ch8_A* 3uez_A* 4adf_A* 4adq_A* | Back alignment and structure |
|---|
| >3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1pko_A Myelin oligodendrocyte glycoprotein; IGV-domain, immune system; 1.45A {Rattus norvegicus} SCOP: b.1.1.1 PDB: 1pkq_E 3csp_A 1py9_A | Back alignment and structure |
|---|
| >2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 | Back alignment and structure |
|---|
| >4fom_A Poliovirus receptor-related protein 3; immunoglobulin-like domain, IG domain, cell adhesion; HET: NAG BMA MAN FUC; 3.93A {Homo sapiens} | Back alignment and structure |
|---|
| >4gos_A V-SET domain-containing T-cell activation inhibit; immunoglobulin domain, glycoprotein, disulfide bond, immunit adaptive immunity; HET: NAG BMA MAN; 1.59A {Homo sapiens} | Back alignment and structure |
|---|
| >3udw_C Poliovirus receptor; PVR tigit IGSF signal transduction immunology, IGSF, cell SU receptor signalling, glycosylation, membrane protein; HET: NAG; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A | Back alignment and structure |
|---|
| >3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1eaj_A Coxsackie virus and adenovirus receptor; virus/viral protein receptor, immunoglobulin V domain fold, symmetric dimer; 1.35A {Homo sapiens} SCOP: b.1.1.1 PDB: 1f5w_A 2j12_B 2j1k_A 2wbw_B* 2w9l_A* 1rsf_A 1jew_R 1kac_B 1p69_B 1p6a_B | Back alignment and structure |
|---|
| >2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3so5_A LIG-3, leucine-rich repeats and immunoglobulin-like DOMA protein 3; structural genomics, joint center for struct genomics, JCSG; HET: MLY MSE; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2lu7_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X | Back alignment and structure |
|---|
| >2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3bp6_B Programmed cell death 1 ligand 2; PD-1, PD-L2, complex, costimulation, glycoprotein, immunoglo domain, membrane, transmembrane, receptor; 1.60A {Mus musculus} PDB: 3bp5_B 3rnq_B 3bov_A 3rnk_B | Back alignment and structure |
|---|
| >2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A | Back alignment and structure |
|---|
| >2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2or8_A Hepatitis A virus cellular receptor 1 homolog; beta barrel, immunoglobulin fold, IGV domain, TIM, immune system; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1zox_A CLM-1; IG-superfamily, IG-V, NKP44-like, myeloid IG-like receptor, structural genomics, PSI, protein structure initiative; 2.10A {Mus musculus} | Back alignment and structure |
|---|
| >2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A | Back alignment and structure |
|---|
| >2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} | Back alignment and structure |
|---|
| >3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} PDB: 4exp_X* | Back alignment and structure |
|---|
| >4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3rrq_A Protein PD-1, programmed cell death protein 1; programmed death-1, costimulatory, immune system; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A | Back alignment and structure |
|---|
| >1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A | Back alignment and structure |
|---|
| >3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3q0h_A T cell immunoreceptor with IG and ITIM domains; immune receptor, adhesion, structural genomics, NEW YORK STR genomics research consortium, nysgrc; 1.70A {Homo sapiens} PDB: 3rq3_A 3udw_A* 3ucr_A | Back alignment and structure |
|---|
| >2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A | Back alignment and structure |
|---|
| >4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A | Back alignment and structure |
|---|
| >2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A | Back alignment and structure |
|---|
| >1neu_A Myelin P0 protein; structural protein, glycoprotein, transmembrane, phosphorylation, immunoglobulin fold, signal; 1.90A {Rattus norvegicus} SCOP: b.1.1.1 | Back alignment and structure |
|---|
| >1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A | Back alignment and structure |
|---|
| >2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A | Back alignment and structure |
|---|
| >2oyp_A Hepatitis A virus cellular receptor 2; TIM-3, T-cell immunoglobulin mucin, signaling protein; 1.95A {Mus musculus} PDB: 3kaa_A* | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} | Back alignment and structure |
|---|
| >1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A | Back alignment and structure |
|---|
| >2or7_A T-cell immunoglobulin and mucin domain- containing protein 2; beta barrel, immunoglobulin fold, IGV domain, TIM, immune system; 1.50A {Mus musculus} | Back alignment and structure |
|---|
| >2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A | Back alignment and structure |
|---|
| >3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3khq_A B-cell antigen receptor complex-associated protei chain; CD79B, CD79A, IG-beta, BCR, IG domain, V-SET, immunoglobulin protein binding; HET: FLC GSH; 1.70A {Mus musculus} PDB: 3kho_A* | Back alignment and structure |
|---|
| >2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A | Back alignment and structure |
|---|
| >4gjt_B Poliovirus receptor-related protein 4; six-bladed -propeller, IGV-like fold, viral entry, MV-H, NEC BETA4/BETA5 groove; HET: NAG; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* | Back alignment and structure |
|---|
| >1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 | Back alignment and structure |
|---|
| >4i0k_A CD276 antigen; immunoglobulin domain, glycoprotein, immunity, adaptive IMMU structural genomics, protein structure initiative; HET: NAG BMA MAN; 2.97A {Mus musculus} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A | Back alignment and structure |
|---|
| >3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* | Back alignment and structure |
|---|
| >3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2lvc_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 | Back alignment and structure |
|---|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} | Back alignment and structure |
|---|
| >2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A | Back alignment and structure |
|---|
| >3pv7_A B7-H6, IG-like domain-containing protein DKFZP686O24166/DKFZP686I21167; NK cell receptor, receptor-ligand complex, immune system; HET: NAG; 2.00A {Homo sapiens} PDB: 3pv6_A* | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1dr9_A B7-1 (CD80), T lymphocyte activation antigen; IG superfamily, immune system; HET: NAG; 3.00A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1i8l_A* | Back alignment and structure |
|---|
| >1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R | Back alignment and structure |
|---|
| >2qsq_A Carcinoembryonic antigen-related cell adhesion MO; glycoprotein, GPI-anchor, immunoglobulin DOMA lipoprotein, membrane; 1.95A {Homo sapiens} PDB: 2qst_A 2ver_N* 2gk2_A | Back alignment and structure |
|---|
| >2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A | Back alignment and structure |
|---|
| >3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* | Back alignment and structure |
|---|
| >2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A | Back alignment and structure |
|---|
| >3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* | Back alignment and structure |
|---|
| >2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A | Back alignment and structure |
|---|
| >1xt5_A Variable region-containing chitin-binding protein 3; innate immunity, VCBP, primordial antigen receptor, florida lancelet, amphioxus; 1.15A {Branchiostoma floridae} | Back alignment and structure |
|---|
| >2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A | Back alignment and structure |
|---|
| >3p2t_A Leukocyte immunoglobulin-like receptor subfamily 4; LILR, IG, inhibitory receptor, disulfide, immune system; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A | Back alignment and structure |
|---|
| >3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* | Back alignment and structure |
|---|
| >1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A | Back alignment and structure |
|---|
| >2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J | Back alignment and structure |
|---|
| >3mj8_L Stimulatory hamster antibody HL4E10 FAB light CHA; hamster IGG, immune system; 2.94A {Cricetulus migratorius} PDB: 3mj9_L* | Back alignment and structure |
|---|
| >1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A | Back alignment and structure |
|---|
| >2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} | Back alignment and structure |
|---|
| >2nms_A CMRF35-like-molecule 1; IG-superfamily, IG-V, NKP44-like, myeloid IG-like receptor, inhibitory receptor, myelo-monocytic cells; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 4fmf_A* 3sku_E* 2l7j_A | Back alignment and structure |
|---|
| >2eo1_A OBSCN protein, cDNA FLJ14124 FIS, clone mamma1002498; beta-sandwich, IG-fold, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2if7_A SLAM family member 6; NTB-A, homophilic receptor, immune system; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A | Back alignment and structure |
|---|
| >1ccz_A Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1ci5_A 1qa9_B | Back alignment and structure |
|---|
| >1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >1pd6_A Cardiac MYBP-C;, myosin-binding protein C, cardiac-type, domain C2; IG domain, structural protein; NMR {Homo sapiens} SCOP: b.1.1.4 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4fa8_A Secreted protein BARF1; immunoglobulin-like domains, 4-helix bundle fold, viral PROT cytokine complex; HET: NAG BMA; 2.20A {Human herpesvirus 4} PDB: 2ch8_A* 3uez_A* 4adf_A* 4adq_A* | Back alignment and structure |
|---|
| >2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2q87_A CMRF35-H antigen; all-beta, immunoglobulin, IG-superfamily, IG-V, NKP44-like, natural killer cell IG-like receptor, inhibitory receptor; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1gsm_A Madcam-1, mucosal addressin cell adhesion molecule-1; cell adhesion protein, immunoglobulin fold, I-SET fold, cell adhesion glycoprotein; 1.9A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1bqs_A* | Back alignment and structure |
|---|
| >4frw_A Poliovirus receptor-related protein 4; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C | Back alignment and structure |
|---|
| >2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} | Back alignment and structure |
|---|
| >2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A | Back alignment and structure |
|---|
| >3s96_B 3B5H10 FAB light chain; huntingtin, immune system; 1.90A {Mus musculus} PDB: 2qhr_L 3ffd_B 4dcq_A | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R | Back alignment and structure |
|---|
| >2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* | Back alignment and structure |
|---|
| >3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* | Back alignment and structure |
|---|
| >1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G | Back alignment and structure |
|---|
| >2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A | Back alignment and structure |
|---|
| >2xzc_L FAB A.17 light chain; immune system; HET: XOP; 1.36A {Homo sapiens} PDB: 2xza_L* 3kdm_L* 3nps_C 1dn0_A 1qlr_A* 2v7n_A 3eo0_A 3eo1_A 2agj_L* 2fx7_L 1tzg_L 2fx8_L 2fx9_L* 1u6a_L 3hi1_L* 3kym_A 3kyk_L 3qwo_L* 3ixt_L* 3qeg_L ... | Back alignment and structure |
|---|
| >1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A | Back alignment and structure |
|---|
| >2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J | Back alignment and structure |
|---|
| >3tv3_L PGT128 light chain, IG lambda-2 chain C regions; FAB, HIV-1 neutralizing antibody, GP120, immune system; HET: PCA MAN GOL EPE; 1.29A {Homo sapiens} PDB: 3tyg_L* 3twc_L* 3tnm_L 2mcg_1 1mcw_M 1a8j_L 3mcg_1 1dcl_A 1mcb_A* 1mcc_A* 1mcd_A* 1mce_A* 1mcf_A* 1mch_A 1mci_A* 1mcj_A* 1mck_A 1mcl_A* 1mcn_A* 1mcq_A ... | Back alignment and structure |
|---|
| >4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} PDB: 4exp_X* | Back alignment and structure |
|---|
| >1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 | Back alignment and structure |
|---|
| >2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3d9a_L Light chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_L 1xgp_A 1xgq_A 1xgr_A 1xgt_A 1dqq_A 1dqm_L 1dqj_A 1nby_A 1nbz_A 1ndg_A 1ndm_A 1xgu_A 1fh5_L 1bm3_L 1opg_L 1mlb_A 1mlc_A 1rih_L 1p2c_A ... | Back alignment and structure |
|---|
| >2e6q_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} | Back alignment and structure |
|---|
| >2pet_A Lutheran blood group glycoprotein; immunoglobulin superfamily., cell adhesion; 1.70A {Homo sapiens} PDB: 2pf6_A | Back alignment and structure |
|---|
| >2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A | Back alignment and structure |
|---|
| >2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* | Back alignment and structure |
|---|
| >3bia_X T-cell immunoglobulin and mucin domain- containing protein 4; beta barrel, immunoglobulin fold, IGV domain, TIM, glycoprotein; HET: TLA; 2.20A {Mus musculus} PDB: 3bi9_X* 3bib_X* | Back alignment and structure |
|---|
| >2ptt_A CD48 antigen; CD244, CD48, NK cell receptor, X-RAY, immune system; 1.63A {Mus musculus} PDB: 2ptv_A | Back alignment and structure |
|---|
| >3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* | Back alignment and structure |
|---|
| >3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} | Back alignment and structure |
|---|
| >1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E | Back alignment and structure |
|---|
| >1ugn_A LIR1, leukocyte immunoglobulin-like receptor 1; immunoglobulin-like folds, immune system; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 3d2u_D* 1g0x_A 1p7q_D 1ufu_A 1vdg_A 2gw5_A 2dyp_D 2otp_A 3q2c_A | Back alignment and structure |
|---|
| >1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A | Back alignment and structure |
|---|
| >3r0n_A Poliovirus receptor-related protein 2; IG-domain, cell-adhesion molecule, virus entry receptor, STR genomics, PSI-biology; 1.30A {Homo sapiens} PDB: 4dfh_A 4dfi_A | Back alignment and structure |
|---|
| >2d3v_A Leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1; immunoglobulin-like fold, immune system; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >4fmk_A Poliovirus receptor-related protein 2; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA MAN FUC; 2.56A {Mus musculus} PDB: 4fn0_A* 4fs0_A* | Back alignment and structure |
|---|
| >1lk3_L 9D7 light chain; antigen-antibody complex, immune system; 1.91A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 1fn4_A 1c5d_L 1bfo_A 3b9k_L* | Back alignment and structure |
|---|
| >2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* | Back alignment and structure |
|---|
| >1ugn_A LIR1, leukocyte immunoglobulin-like receptor 1; immunoglobulin-like folds, immune system; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 3d2u_D* 1g0x_A 1p7q_D 1ufu_A 1vdg_A 2gw5_A 2dyp_D 2otp_A 3q2c_A | Back alignment and structure |
|---|
| >3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4fmk_A Poliovirus receptor-related protein 2; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA MAN FUC; 2.56A {Mus musculus} PDB: 4fn0_A* 4fs0_A* | Back alignment and structure |
|---|
| >4fom_A Poliovirus receptor-related protein 3; immunoglobulin-like domain, IG domain, cell adhesion; HET: NAG BMA MAN FUC; 3.93A {Homo sapiens} | Back alignment and structure |
|---|
| >3r06_A Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; anti-CD3epsilon, T-cell receptor, signalling, IMMU; 2.50A {Cricetulus migratorius} PDB: 3r08_L 3ld8_B 3ldb_B* | Back alignment and structure |
|---|
| >3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* | Back alignment and structure |
|---|
| >2d9c_A Signal-regulatory protein beta-1; beta-sandwich, SIRP-beta-1, CD172B antigen, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} | Back alignment and structure |
|---|
| >3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* | Back alignment and structure |
|---|
| >2zg1_A Sialic acid-binding IG-like lectin 5; siglec-5 inhibitory receptor, two-domain structure, V-SET, C2-SET, IG-like domain, 6'-sialyllactose complex; HET: SIA; 2.70A {Homo sapiens} PDB: 2zg3_A* 2zg2_A | Back alignment and structure |
|---|
| >3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* | Back alignment and structure |
|---|
| >3p2t_A Leukocyte immunoglobulin-like receptor subfamily 4; LILR, IG, inhibitory receptor, disulfide, immune system; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 | Back alignment and structure |
|---|
| >2dru_A Chimera of CD48 antigen and T-cell surface antige; CD2 binding domain of CD48, immune system; HET: NAG; 2.60A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* | Back alignment and structure |
|---|
| >2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2gi7_A GPVI protein; IG-like domains, blood clotting, cell adhesion; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} | Back alignment and structure |
|---|
| >2h32_A Immunoglobulin IOTA chain; beta sheets, V and C-type IG folds, immune system; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* | Back alignment and structure |
|---|
| >3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A | Back alignment and structure |
|---|
| >2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1za6_B IGG heavy chain; immunoglobulin fold, CH2-domain-deletion, immune system; 2.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 | Back alignment and structure |
|---|
| >1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >1f3r_B FV antibody fragment; IG-fold, immuno complex, antibody-antigen, beta-turn, immune system; HET: NLE; NMR {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.1 | Back alignment and structure |
|---|
| >3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3sob_L Antibody light chain; beta propeller, protein binding-immune system complex; 1.90A {Homo sapiens} PDB: 1pkq_A 3u1s_L* | Back alignment and structure |
|---|
| >3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1moe_A Anti-CEA MAB T84.66; anti carcinoembryonic antigen, diabody, dimer, SCFV, variable domain, immune system; 2.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 | Back alignment and structure |
|---|
| >1op3_H FAB 2G12, heavy chain; domain-swapped FAB 2G12, anti-carbohydrate antibody, immune system; HET: MAN; 1.75A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1om3_H* 1op5_H* 3oay_M* 1zlu_H* 1zlv_H* 1zlw_H* 2oqj_B 1zls_H* 3ob0_H* 3oau_H* 3oaz_H* 3ghe_H 3eyf_B 3eyo_B 3ghb_H 3c2a_H 1q1j_H 2fl5_H* | Back alignment and structure |
|---|
| >1h5b_A Murine T cell receptor (TCR) valpha domain; immune response, immunoglobulin fold; 1.85A {Mus musculus} SCOP: b.1.1.1 PDB: 1h5b_C 1h5b_B | Back alignment and structure |
|---|
| >2ghw_B Anti-SARS SCFV antibody, 80R; S protein, neutralizing antibody, virus/viral protein/antibiotic complex; 2.30A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 | Back alignment and structure |
|---|
| >2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* | Back alignment and structure |
|---|
| >1q9r_B S25-2 FAB (IGG1K) heavy chain; antigen-binding fragment, anti-carbohydrate, anti-LPS, antibody, immunoglobulin, KDO, complex, immune system; HET: KDA KDO; 1.45A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q9l_B 1q9k_B* 1q9q_B* 1q9v_B* 2r1w_B* 2r1x_B* 2r1y_B* 2r2b_B* 2r2e_B* 2r2h_B* 3bpc_B* 3sy0_B* 3t4y_B* 3t65_B* 2r23_B* 1q9t_B* 3t77_B* 3okl_B* 3okk_B* 3okm_B ... | Back alignment and structure |
|---|
| >1oll_A NK receptor; immune system/receptor, NK cell triggering receptor, immune system, IG domain, cytotoxicity, C2-type IG-like domains; 1.93A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A | Back alignment and structure |
|---|
| >2edo_A CD48 antigen; beta-sandwich, IG-fold, B-lymphocyte activation marker blast-1, BCM1 surface antigen, leukocyte antigen MEM-102, TCT.1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* | Back alignment and structure |
|---|
| >3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1ncn_A T lymphocyte activation antigen CD86; IG V, beta strands, immune system; 2.70A {Homo sapiens} SCOP: b.1.1.1 PDB: 1i85_A | Back alignment and structure |
|---|
| >1jhl_L IGG1-kappa D11.15 FV (light chain); complex(antibody-antigen); 2.40A {Mus musculus} SCOP: b.1.1.1 | Back alignment and structure |
|---|
| >1nko_A Sialic acid binding IG-like lectin 7; immunoglobulin, siglec7, immune system; 1.45A {Homo sapiens} SCOP: b.1.1.1 PDB: 2g5r_A* 1o7v_A* 2df3_A* 1o7s_A* 2hrl_A* | Back alignment and structure |
|---|
| >2v9t_A Roundabout homolog 1; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 | Back alignment and structure |
|---|
| >3juy_B 3B3 single chain variant HIV-1 antibody; envelope protein GP120, broadly neutralizing antibody, 3B3 single chain variable fragment, immune system; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A | Back alignment and structure |
|---|
| >1dee_B IGM RF 2A2; FAB-IBP complex 2.7A resolution binding outside the antigen combining site superantigen FAB VH3 specificity; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1hez_B 1adq_H | Back alignment and structure |
|---|
| >1qok_A MFE-23 recombinant antibody fragment; immunoglobulin, single-chain FV, anti-carcinoembryonic antigen; 2.4A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 | Back alignment and structure |
|---|
| >1nqb_A Single-chain antibody fragment; multivalent antibody, diabody, domain SWA immunoglobulin; 2.00A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 PDB: 1lmk_A 1qnz_H | Back alignment and structure |
|---|
| >3o3u_N Maltose-binding periplasmic protein, advanced Gly END product-specific receptor; RAGE, AGER, scavenger receptor; HET: MLR; 1.50A {Escherichia coli} PDB: 3s59_A 3s58_A 3cjj_A 2l7u_A* 2e5e_A | Back alignment and structure |
|---|
| >1q0x_L FAB 9B1, light chain; anti-morphine antibody, FAB fragment, immune system; HET: PG4; 1.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q0y_L* 1ngp_L* 1ngq_L 3ks0_L* 1gig_L 2vir_A 2vis_A* 2vit_A 1sm3_L 4a6y_L 1ind_L* 1ine_L* 1yuh_L* 2zpk_L 3rhw_K* 3ri5_K* 3ria_K* 3rif_K* 1mfe_L* 1mfb_L* ... | Back alignment and structure |
|---|
| >1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A | Back alignment and structure |
|---|
| >3omz_A Human vdelta1 gamma delta T cell receptor delta1A; immunoglobulin fold, immune surveillance of cell stress PROT A/B, MIC-A/B binding, epithelium; 3.04A {Homo sapiens} | Back alignment and structure |
|---|
| >3vh8_G Killer cell immunoglobulin-like receptor 3DL1; immunoglobulin fold, natural killer cell receptor, immune SY; HET: NAG; 1.80A {Homo sapiens} PDB: 1im9_D | Back alignment and structure |
|---|
| >2wng_A Tyrosine-protein phosphatase non-receptor type substrate 1; signal regulatory protein alpha, immunoglobulin superfamily, phosphoprotein; HET: NAG; 2.49A {Homo sapiens} | Back alignment and structure |
|---|
| >1c1e_H Catalytic antibody 1E9 (heavy chain); diels-alder, immunoglobulin, immune system; HET: ENH; 1.90A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1dbb_H* 1dba_H* 1dbj_H* 1dbk_H* 1dbm_H* 2dbl_H* 3ojd_B 1jgl_H* 1jhk_H 1ghf_H 1tet_H* 3e8u_H 1fj1_B 1cl7_H | Back alignment and structure |
|---|
| >3d9a_H Heavy chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_H 1gpo_H 3ks0_H* 1dqd_H 1ndm_B 1nak_H 1dqq_B 1dqm_H 1dqj_B 1nby_B 1nbz_B 1xgu_B 1ndg_B 1xgt_B 1xgp_B 1xgq_B 1xgr_B 1s5i_H 1f8t_H 1f90_H ... | Back alignment and structure |
|---|
| >2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2jjs_C Leukocyte surface antigen CD47; signal regulatory protein alpha, immunoglobulin superfamily, transmembrane, phosphoprotein, paired receptor; HET: NAG; 1.85A {Homo sapiens} PDB: 2jjt_C* 2vsc_A* | Back alignment and structure |
|---|
| >1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G | Back alignment and structure |
|---|
| >3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A | Back alignment and structure |
|---|
| >1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* | Back alignment and structure |
|---|
| >3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2fbj_H IGA-kappa J539 FAB (heavy chain); immunoglobulin; HET: NAG FUC; 1.95A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mcp_H 2mcp_H* | Back alignment and structure |
|---|
| >1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A | Back alignment and structure |
|---|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1qgc_4 Protein (immunoglobulin); virus-antibody complex, icosahedral virus, virus-immune SYST complex; 30.00A {Mus musculus} SCOP: i.6.1.1 | Back alignment and structure |
|---|
| >2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3bae_H WO2 IGG2A FAB fragment heavy chain; abeta, FAB, WO2, alzheimer'S disease, immunotherapies, APP, immune system; 1.59A {Mus musculus} SCOP: b.1.1.2 PDB: 3bkc_H 3bkj_H 3bkm_H 3mck_H 2r0w_H* 2iqa_H 2iq9_H 1ggi_H 1ggb_H 1ggc_H 3eys_H* 2ipt_H 2ipu_H 3eyu_H* 2r0z_H* 3rkd_H 1r0a_H* 1n5y_H* 1n6q_H* 1t03_H* ... | Back alignment and structure |
|---|
| >2j6e_L IGM, FAB light chain; autoimmune complex human IGM rheumatoid factor IGG1-FC, immunoglobulin C region, membrane, glycoprotein, transmembrane; HET: NAG FUL BMA MAN NDG GAL; 3.0A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 | Back alignment and structure |
|---|
| >3gkz_A Anti-methamphetamine single chain FV; therapeutic antibody, MDMA, IGG, immune system; HET: B40; 1.90A {Mus musculus} PDB: 3gm0_A* 1rvf_L 3ab0_C 2a0l_C 3iy5_A | Back alignment and structure |
|---|
| >3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1uct_A Immunoglobulin alpha FC receptor; beta stands, immune system; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1ovz_A* 1ow0_C* | Back alignment and structure |
|---|
| >1pz5_B Heavy chain of FAB (SYA/J6); antibody-antigen structure, peptide-carbohydrate mimicry, VA design, immune system; 1.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1m7d_B* 1m71_B* 1m7i_B* 1r24_B 1uz6_F 1uz8_B* 1clz_H* | Back alignment and structure |
|---|
| >1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A | Back alignment and structure |
|---|
| >3bkj_L WO2 IGG2A FAB fragment light chain kappa; abeta, FAB, WO2, alzheimer'S disease, immunotherapies, APP, immune system; 1.59A {Mus musculus} PDB: 3bkc_L 3bkm_L 2zuq_B* 1h3p_L | Back alignment and structure |
|---|
| >3m8o_H Immunoglobulin A1 heavy chain; immunoglobulin fold, immune system; 1.55A {Homo sapiens} PDB: 3qnx_B 3qny_B | Back alignment and structure |
|---|
| >2c1o_A IGK-C protein; FAB fragment, enantioselective, finrozole, immune system, antibody, ENA11His antibody, immunoglobulin domain; 2.75A {Mus musculus} | Back alignment and structure |
|---|
| >2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3uzq_A Anti-dengue MAB 4E11; dengue antibody neutralization, immune system; HET: MES; 1.60A {Mus musculus} PDB: 3uze_A* 3uyp_A* 3uzv_B 1dzb_A | Back alignment and structure |
|---|
| >1svz_A Immunoglobulin;, single-chain FV fragment 1696; antibody-antigen complex, HIV inhibiting antibody; 1.89A {Mus musculus} PDB: 1jp5_A | Back alignment and structure |
|---|
| >4fqp_A Poliovirus receptor; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA FUC MAN; 3.60A {Homo sapiens} PDB: 1nn8_R 1dgi_R | Back alignment and structure |
|---|
| >3tf7_C 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; IG and MHC, antigen recognition, TCR-PMHC, membrane receptor system; 2.75A {Mus musculus} | Back alignment and structure |
|---|
| >3pl6_D MBP peptide / T-cell receptor beta chain chimera; TCR-MHC complex, immunoglobulin fold, immune receptor, membr immune system; HET: NAG; 2.55A {Homo sapiens} | Back alignment and structure |
|---|
| >1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 | Back alignment and structure |
|---|
| >4i0k_A CD276 antigen; immunoglobulin domain, glycoprotein, immunity, adaptive IMMU structural genomics, protein structure initiative; HET: NAG BMA MAN; 2.97A {Mus musculus} | Back alignment and structure |
|---|
| >1c5d_H Monoclonal antibody against the main immunogenic the human muscle acetylcholine receptor...; immunoglobulin, immune system; 2.40A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 2arj_H 3b9k_H* 2gk0_H 2gjz_H 1fn4_B 3mj8_H 3mj9_H* | Back alignment and structure |
|---|
| >3uzq_A Anti-dengue MAB 4E11; dengue antibody neutralization, immune system; HET: MES; 1.60A {Mus musculus} PDB: 3uze_A* 3uyp_A* 3uzv_B 1dzb_A | Back alignment and structure |
|---|
| >3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 4fmf_A* 3sku_E* 2l7j_A | Back alignment and structure |
|---|
| >3ux9_B SCFV antibody; five helices, long loop connecting helix, hydrophobic intera cytokine-immune system complex; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3umt_A SCFV heavy chain and light chain; stability engineering, anthrax, anti-BCLA antibody, immunoglobulin fold (VH and VL domains), antibody, immune S; HET: NHE; 1.80A {Mus musculus} PDB: 1xiw_D | Back alignment and structure |
|---|
| >2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... | Back alignment and structure |
|---|
| >3kg5_A B-cell antigen receptor complex-associated protei chain; CD79B, IG-beta, BCR, immunoglobulin domain, protein binding; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3liz_H 4C3 monoclonal antibody heavy chain; hydrolase-immune system complex; HET: NAG BMA MAN; 1.80A {Mus musculus} PDB: 3rvv_D* 3rvu_D 3rvt_D* 3rvw_D* 3rvx_D 1lo4_H 1ub6_H 3r06_B 3r08_H | Back alignment and structure |
|---|
| >3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} | Back alignment and structure |
|---|
| >4dzb_B Vbeta2 (MAIT T cell receptor); immune system; 1.70A {Homo sapiens} PDB: 1ymm_E* 3o4l_E* 3o6f_D 3t0e_D 1ktk_E 3mfg_B 2ij0_E | Back alignment and structure |
|---|
| >1nkr_A P58-CL42 KIR; inhibitory receptor, natural killer cells, immunological receptors, immunoglobulin fold; 1.70A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1m4k_A 1efx_D 2dli_A 2dl2_A 3h8n_A | Back alignment and structure |
|---|
| >3bik_B Programmed cell death protein 1; CO-stimulation, receptor-ligand complex, immunoglobulin-like sandwich, T cell, B cell, programmed death; 2.65A {Mus musculus} SCOP: b.1.1.1 | Back alignment and structure |
|---|
| >2ywz_A NEW antigen receptor variable domain; IG VNAR, immune system; 2.21A {Orectolobus maculatus} PDB: 2ywy_A | Back alignment and structure |
|---|
| >2p1y_A Bispecific alpha/beta TCR; autoimmunity, immunoglobulin fold, diabody, immune system; 2.42A {Mus musculus} PDB: 1bwm_A | Back alignment and structure |
|---|
| >3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2rcj_C Light chain; immunoglobulin M, polymeric antibodies, immunology, X-RAY solution scattering, constrained modelling, immune system; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3bn9_D E2 FAB heavy chain; antibody-protease complex, protein-protein complex, enzyme- inhibitor complex, disease mutation, glycoprotein, hydrolase; 2.17A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 3kr3_H 2xtj_E | Back alignment and structure |
|---|
| >2znx_A SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, single chain FV, allergen, antimicrobial, bacteriolytic enzyme, glycosidase, hydrolase; HET: FTR 1PG; 2.30A {Homo sapiens} PDB: 2znw_A* | Back alignment and structure |
|---|
| >2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3auv_A SC-DSFV derived from the G6-FAB; SC-DSFV (disulfide-stabilized SCFV), SCFV, monovalent antibo antibody engineering, immune system; 2.40A {Homo sapiens} PDB: 2kh2_B 3iy0_L | Back alignment and structure |
|---|
| >1hzh_H IGG, immunoglobulin heavy chain; antibody, immune system; HET: NAG BMA MAN GAL FUC; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 PDB: 2ig2_H 1mco_H* | Back alignment and structure |
|---|
| >1qgc_4 Protein (immunoglobulin); virus-antibody complex, icosahedral virus, virus-immune SYST complex; 30.00A {Mus musculus} SCOP: i.6.1.1 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A | Back alignment and structure |
|---|
| >3bqu_C 3H6 FAB light chain; beta sheet, immune system; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2p1y_A Bispecific alpha/beta TCR; autoimmunity, immunoglobulin fold, diabody, immune system; 2.42A {Mus musculus} PDB: 1bwm_A | Back alignment and structure |
|---|
| >2coq_A NEW antigen receptor variable domain; IG VNAR, natural TYPE2, immune system; 2.10A {Orectolobus maculatus} | Back alignment and structure |
|---|
| >1pew_A JTO2, A lambda-6 type immunoglobulin light chain, domain; beta sheet, immune system; 1.60A {Homo sapiens} SCOP: b.1.1.1 PDB: 1cd0_A 1pw3_A 2cd0_A 2w0k_A 3b5g_A 3bdx_A* 2w0l_A | Back alignment and structure |
|---|
| >4hwn_A FC receptor-like A; FCRLA, FCRL, IG-C2 domain, IG superfamily, immune system, ST genomics, PSI-biology; 2.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1mqk_L Antibody 7E2 FV fragment, light chain; membrane protein, cytochrome C oxidase, high- resolution structure, immune system; 1.28A {Mus musculus} SCOP: b.1.1.1 PDB: 1ar1_D 3ehb_D* 3hb3_D* 1qle_L* 1f6l_L 3iy2_A 1vfa_A 1dvf_A 1kir_A 1g7i_A 1g7j_A 1a2y_A 1kip_A 1kiq_A 1vfb_A 1g7h_A 1a7o_L 1g7l_A 1g7m_A 1a7n_L ... | Back alignment and structure |
|---|
| >1qfw_M FV, antibody (anti beta subunit) (light chain); glycoprotein hormone; HET: NAG; 3.50A {Mus musculus} SCOP: b.1.1.1 | Back alignment and structure |
|---|
| >4frw_A Poliovirus receptor-related protein 4; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3d85_D IL-12B, interleukin-12 subunit P40, cytotoxic lymphocyte; FAB, immune system/cytokine complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 3d87_B* 3duh_A* 1f42_A* 1f45_A* 3hmx_A* 3qwr_A* | Back alignment and structure |
|---|
| >1oll_A NK receptor; immune system/receptor, NK cell triggering receptor, immune system, IG domain, cytotoxicity, C2-type IG-like domains; 1.93A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >1mju_H Immunoglobulin MS6-12; catalytic antibody, ester hydrolysis, esterolytic, FAB, immune system; 1.22A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mjj_B 1mie_H 1mj7_H* 1mj8_H 1mh5_B* 4aeh_H 2y5t_A 2vwe_E 2op4_H 2ntf_H 3loh_C 1e4x_H 2vl5_A 1e4x_I 1e4w_H 3opz_H 3oz9_H 1plg_H 1hi6_B 1cfn_B ... | Back alignment and structure |
|---|
| >3tf7_C 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; IG and MHC, antigen recognition, TCR-PMHC, membrane receptor system; 2.75A {Mus musculus} | Back alignment and structure |
|---|
| >3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3esu_F Antibody 14B7* light chain and antibody 14B7* heavy chain linked with A synthetic...; single-chain FV, monoclonal antibody, immunoglobulin; 1.30A {Mus musculus} PDB: 3et9_F 3esv_F 3etb_F 1h8n_A 1h8s_A* 1h8o_A* | Back alignment and structure |
|---|
| >1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >2xqy_G A13-D6.3 monoclonal antibody, envelope glycoprotein H; immune system-viral protein complex, envelope protein; HET: NAG; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >3qhz_H Human monoclonal antibody DEL2D1, FAB heavy chain; immunoglobulin, immune recognition, influenza A hemagglutini system; 1.55A {Homo sapiens} PDB: 3lzf_H* 3qrg_H* 3mod_H 3mob_H 3moa_H 3lev_H* 3idg_B 3d0l_B 3d0v_B 3idi_B 3idj_B 3idm_B* 3idn_B* 1tjg_H* 1tjh_H* 1tji_H* 2pr4_H 3drq_B 2p8m_B 2p8p_B ... | Back alignment and structure |
|---|
| >1tvd_A T cell receptor, ES204 V delta; immunoreceptor, TCR, delta chain, variable domain; 1.90A {Homo sapiens} SCOP: b.1.1.1 | Back alignment and structure |
|---|
| >1dn0_B IGM-kappa cold agglutinin (heavy chain); FAB, antibody, human, immune system; 2.28A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1qlr_B* 2j6e_H* 2agj_H* 2h32_H | Back alignment and structure |
|---|
| >1nfd_E H57 FAB; complex (immunoreceptor-immunoglobulin), complex (immunorece immunoglobulin) complex; HET: NAG NDG; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 | Back alignment and structure |
|---|
| >1igt_B IGG2A intact antibody - MAB231; intact immunoglobulin V region C region, immunoglobulin; HET: NAG FUL BMA MAN GAL FUC; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 | Back alignment and structure |
|---|
| >2ghw_B Anti-SARS SCFV antibody, 80R; S protein, neutralizing antibody, virus/viral protein/antibiotic complex; 2.30A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 | Back alignment and structure |
|---|
| >1uct_A Immunoglobulin alpha FC receptor; beta stands, immune system; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1ovz_A* 1ow0_C* | Back alignment and structure |
|---|
| >1dlf_H Anti-dansyl immunoglobulin IGG2A(S); FV fragment; 1.45A {Mus musculus} SCOP: b.1.1.1 PDB: 2dlf_H 1wz1_H* 3iy5_B 2uud_H* | Back alignment and structure |
|---|
| >1xed_A Polymeric-immunoglobulin receptor; IG-like fold, immune system; 1.90A {Homo sapiens} SCOP: b.1.1.1 | Back alignment and structure |
|---|
| >1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E | Back alignment and structure |
|---|
| >2d3v_A Leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1; immunoglobulin-like fold, immune system; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3gkz_A Anti-methamphetamine single chain FV; therapeutic antibody, MDMA, IGG, immune system; HET: B40; 1.90A {Mus musculus} PDB: 3gm0_A* 1rvf_L 3ab0_C 2a0l_C 3iy5_A | Back alignment and structure |
|---|
| >4ei6_B Vbeta16 XV19 type II natural killer T cell recept variable domain, human constant...; natural killer T cell receptor, immune system; 1.60A {Mus musculus} PDB: 4ei5_D 4elk_B 4elm_F* 2esv_E 3ffc_E 3utt_E 3utp_E* 3uts_E 3qjf_B 3qjh_B 3qiw_D* 3qiu_D | Back alignment and structure |
|---|
| >1u9k_A Triggering receptor expressed on myeloid cells 1; activating receptors, TREM-1, innate immunity, immune system receptor, immune system; 1.76A {Mus musculus} SCOP: b.1.1.1 | Back alignment and structure |
|---|
| >1iga_A IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg_A 2qtj_A 3chn_A 1r70_B 3cm9_A | Back alignment and structure |
|---|
| >3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* | Back alignment and structure |
|---|
| >4ffy_L DENV1-E111 single chain variable fragment (light; viral envelope proteins, structural genomics, antibody epito flavivirus, niaid; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >2pnd_A V-SET and immunoglobulin domain containing 4; complement receptor, IG-like domain, immune system; 1.00A {Mus musculus} PDB: 2icc_A 2ice_S* 2icf_S* | Back alignment and structure |
|---|
| >2jju_A Signal regulatory protein beta-1; immunoglobulin domain, immunoglobulin superfamily, immune system, transmembrane, paired receptor; 1.19A {Homo sapiens} PDB: 2jjv_A 2uv3_A* 2jjt_A* 2jjs_A* 2jjw_A | Back alignment and structure |
|---|
| >3f8u_B Tapasin; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1sq2_N Novel antigen receptor; immunoglobulin fold, protein-protein complex, hydrolase/immune system complex; 1.45A {Ginglymostoma cirratum} SCOP: b.1.1.1 PDB: 1t6v_N | Back alignment and structure |
|---|
| >2q20_A VK1 O18/O8 germline light chain variable domain; Al, light chain amyloidosis, amyloid, immunoglobulin, protein fibril; 1.30A {Homo sapiens} PDB: 2kqm_A 3cdf_A 3cdc_A 2kqn_A 3cdy_A 2q1e_A 3dvi_A 1igm_L 1bww_A 1b0w_A 1bre_A 1qp1_A 3dvf_A 1rei_A 1wtl_A 1ar2_A 1fgv_L 2bx5_A 2uzi_L* 1bvk_A ... | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R | Back alignment and structure |
|---|
| >1i8k_A Epidermal growth factor receptor antibody MR1SCFV light chain; antibody-peptide complex, immunoglobulin fold, type II' beta turn., immune system; 1.80A {Mus musculus} SCOP: b.1.1.1 PDB: 1i8i_A | Back alignment and structure |
|---|
| >1j05_L T84.66 antibody, anti-CEA MAB T84.66, light chain; immunoglobulin, immune system; 1.50A {Mus musculus} SCOP: b.1.1.1 PDB: 1qfw_L* 1qnz_L 3iy3_A 3iy4_A | Back alignment and structure |
|---|
| >3oai_A Maltose-binding periplasmic protein, myelin prote; schwann cell membrane protein, immunoglobulin-folding, inter adhesion, tetramer; HET: MAL; 2.10A {Escherichia coli} | Back alignment and structure |
|---|
| >2vsd_A CHIR AB1; immune system receptor, FC receptor; HET: NAG NDG MAN; 1.82A {Gallus gallus} | Back alignment and structure |
|---|
| >3umt_A SCFV heavy chain and light chain; stability engineering, anthrax, anti-BCLA antibody, immunoglobulin fold (VH and VL domains), antibody, immune S; HET: NHE; 1.80A {Mus musculus} PDB: 1xiw_D | Back alignment and structure |
|---|
| >2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3fku_X Neutralizing antibody F10; influenza, hemagglutinin, SCFV, F membrane, envelope protein, fusion protein, membrane, trans virion; HET: NAG BMA; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1oaq_L Light chain; antibody, allergy, IGE, conformational diversity, multispecificity; 1.50A {Rattus rattus} SCOP: b.1.1.1 PDB: 1ocw_L 2bjm_L* 1oau_L* 1oar_L* 1oaz_L 1mfa_L* 1a6v_L* 1oax_L* 1oay_L* 1a6w_L* 1a6u_L 1dl7_L* | Back alignment and structure |
|---|
| >1p6f_A NKP46, natural cytotoxicity triggering receptor 1; natural cytotoxicity receptor, NK cell receptor, immunoglobulin fold, immune system; 2.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >2gjj_A A21 single-chain antibody fragment against ERBB2; IG family, SCFV, immune system; 2.10A {Mus musculus} PDB: 3h3b_C | Back alignment and structure |
|---|
| >3n9g_H FAB fragment of MAB CR4354, heavy chain; human neutralizing antibody, immun anti-WEST NIle virus; 1.43A {Homo sapiens} PDB: 3iyw_H 3qeh_A 3sqo_H 4hk0_A 4hk3_J 4hkx_A* 3u0t_D 3c08_H 3lmj_H 3lqa_H* 3c09_H* 4dn3_H 3pp4_H 3pp3_H 4hkb_J 2jb5_H* 2jb6_B* 2eh7_H 2eh8_H 3jwd_H* ... | Back alignment and structure |
|---|
| >1xau_A B- and T-lymphocyte attenuator; IG domain, beta sandwich, structural genomics, PSI, protein structure initiative; 1.80A {Mus musculus} SCOP: b.1.1.4 | Back alignment and structure |
|---|
| >2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >1f3r_B FV antibody fragment; IG-fold, immuno complex, antibody-antigen, beta-turn, immune system; HET: NLE; NMR {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.1 | Back alignment and structure |
|---|
| >1bec_A 14.3.D T cell antigen receptor; T cell receptor; 1.70A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1jck_A 1l0x_A 1sbb_A 1l0y_A 3c6l_B 1mwa_B* 1g6r_B* 1tcr_B* 2ckb_B 2q86_B* 1lp9_F 2j8u_F 2jcc_F 2uwe_F 3mbe_D* 1d9k_B* 2aq3_A 3mc0_A 3byt_A 3bzd_A ... | Back alignment and structure |
|---|
| >3pv7_A B7-H6, IG-like domain-containing protein DKFZP686O24166/DKFZP686I21167; NK cell receptor, receptor-ligand complex, immune system; HET: NAG; 2.00A {Homo sapiens} PDB: 3pv6_A* | Back alignment and structure |
|---|
| >2yc1_A Single chain antibody fragment 9004G; immune system-toxin complex, scorpion toxin; 1.90A {Homo sapiens} PDB: 2ybr_A 1dql_H 3cfi_C | Back alignment and structure |
|---|
| >1hkf_A NKP44, NK cell activating receptor; natural cytotoxicity receptor, immunoglobulin domain; 2.2A {Homo sapiens} SCOP: b.1.1.1 | Back alignment and structure |
|---|
| >1ypz_E T cell receptor delta, beta-2-microglobulin; H2-T22 protein, T cell receptor delta, immune system; HET: NAG MAN FUC; 3.40A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 | Back alignment and structure |
|---|
| >2zg1_A Sialic acid-binding IG-like lectin 5; siglec-5 inhibitory receptor, two-domain structure, V-SET, C2-SET, IG-like domain, 6'-sialyllactose complex; HET: SIA; 2.70A {Homo sapiens} PDB: 2zg3_A* 2zg2_A | Back alignment and structure |
|---|
| >2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} | Back alignment and structure |
|---|
| >1x9q_A SCFV, 4M5.3 anti-fluorescein single chain antibody fragment; VERY high affinity, antibody binding, electrostatics, directed evolution; HET: FLU; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1fo0_A Protein (BM3.3 T cell receptor alpha-chain); class I MHC, H-2KB, TCR-PMHC complex, immune system; 2.50A {Mus musculus} SCOP: b.1.1.1 PDB: 1nam_A* | Back alignment and structure |
|---|
| >2e27_L Anti-ciguatoxin antibody, light chain; immunoglobulin fold, immune system; HET: AB0; 1.70A {Mus musculus} PDB: 3iy1_A | Back alignment and structure |
|---|
| >2pkd_A SLAM family member 5; signaling lymphocyte activation molecule, IGV, immunoglobulin variable, IGC, immunoglobulin constant, signaling protein; 2.04A {Homo sapiens} | Back alignment and structure |
|---|
| >1jtp_A Single-domain antibody; immunoglobulin, heavy chain antibody, VHH, interface, binding, antibody, hydrolase; 1.90A {Camelus dromedarius} SCOP: b.1.1.1 PDB: 1jto_A 1mel_A 2x89_A | Back alignment and structure |
|---|
| >1sjv_A R9; camelids antibody, domain swapping, heavy chain antibody, AN; 1.94A {Lama glama} SCOP: b.1.1.1 | Back alignment and structure |
|---|
| >1a2y_B IGG1-kappa D1.3 FV (heavy chain); complex (immunoglobulin/hydrolase), immunoglobulin V region, signal, hydrolase, glycosidase, bacteriolytic enzyme, egg white; 1.50A {Mus musculus} SCOP: b.1.1.1 PDB: 1a7r_H 1dvf_B 1g7h_B 1g7i_B 1g7j_B 1g7l_B 1g7m_B 1kir_B 1vfa_B 1vfb_B 1kiq_B 1a7o_H 1a7n_H 1a7p_H 1kip_B 1a7q_H 1dl7_H* 1bvk_B 1bvl_A 1p4i_H ... | Back alignment and structure |
|---|
| >1mfa_H IGG1-lambda Se155-4 FAB (heavy chain); immunoglobulin; HET: GLA MMA; 1.70A {Mus musculus} SCOP: b.1.1.1 PDB: 3iy2_B | Back alignment and structure |
|---|
| >2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A | Back alignment and structure |
|---|
| >1p6f_A NKP46, natural cytotoxicity triggering receptor 1; natural cytotoxicity receptor, NK cell receptor, immunoglobulin fold, immune system; 2.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >3qib_D 2B4 beta chain; IG domain, immune system; HET: NAG FUC BMA; 2.70A {Mus musculus} | Back alignment and structure |
|---|
| >1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* | Back alignment and structure |
|---|
| >3auv_A SC-DSFV derived from the G6-FAB; SC-DSFV (disulfide-stabilized SCFV), SCFV, monovalent antibo antibody engineering, immune system; 2.40A {Homo sapiens} PDB: 2kh2_B 3iy0_L | Back alignment and structure |
|---|
| >1kxv_C Camelid VHH domain CAB10; beta 8 alpha 8, beta barrel, hydrolase, immune system; 1.60A {Camelus dromedarius} SCOP: b.1.1.1 | Back alignment and structure |
|---|
| >1u3h_A T-cell receptor alpha-chain; complex, immune system; 2.42A {Mus musculus} SCOP: b.1.1.1 PDB: 1b88_A 1kj2_A* 1kb5_A 1d9k_A* | Back alignment and structure |
|---|
| >3u6r_L Antibody 1:7 (light chain); IG-like domain, neutralizing single chain FV, immune system; 2.67A {Homo sapiens} | Back alignment and structure |
|---|
| >1b6u_A KIR2DL3, P58 killer cell inhibitory receptor; natural killer cell, HLA, major histocompatibility complex class I (MHC class I); 3.00A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >3fku_X Neutralizing antibody F10; influenza, hemagglutinin, SCFV, F membrane, envelope protein, fusion protein, membrane, trans virion; HET: NAG BMA; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1n4x_H Immunoglobulin heavy chain variable region; immune system; 1.70A {Mus musculus} SCOP: b.1.1.1 PDB: 3iy4_B | Back alignment and structure |
|---|
| >1j05_H T84.66 antibody, anti-CEA MAB T84.66, heavy chain; immunoglobulin, immune system; 1.50A {Mus musculus} SCOP: b.1.1.1 PDB: 1dvf_D 1mvu_B 1ap2_B 2ap2_B | Back alignment and structure |
|---|
| >2rcj_C Light chain; immunoglobulin M, polymeric antibodies, immunology, X-RAY solution scattering, constrained modelling, immune system; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2wbj_D OB TCR; transmembrane, immune response, T cell receptor, MHC II, MEM receptor, molecular mimicry, multiple sclerosis, immune SYS autoimmunity; HET: NAG BMA MAN; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* | Back alignment and structure |
|---|
| >2gi7_A GPVI protein; IG-like domains, blood clotting, cell adhesion; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1eeq_A Kappa-4 immunoglobulin (light chain); protein stability, hydrogen bonds, immune system; 1.50A {Homo sapiens} SCOP: b.1.1.1 PDB: 1eeu_A 1lve_A 2lve_A 3lve_A 5lve_A 4lve_A 1efq_A 1qac_A 1ek3_A 2imm_A 1mvu_A 2ap2_A 1ap2_A 3bd3_A* 3bd4_A* 3bd5_A* 2imn_A 3dus_A* 3duu_A* 3dv4_A* ... | Back alignment and structure |
|---|
| >3b9v_A Heavy chain variable domain; antibody engineering, phage display, immune system; 1.80A {Homo sapiens} PDB: 1fvc_B 3p9w_B 1fgv_H 2vh5_H* | Back alignment and structure |
|---|
| >2znx_A SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, single chain FV, allergen, antimicrobial, bacteriolytic enzyme, glycosidase, hydrolase; HET: FTR 1PG; 2.30A {Homo sapiens} PDB: 2znw_A* | Back alignment and structure |
|---|
| >1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A | Back alignment and structure |
|---|
| >3q5y_A TCR N15 beta; IG, T cell receptor, antigen peptide/MHC, membrane, immune S; HET: EPE; 1.90A {Mus musculus} PDB: 1nfd_B* 3q5t_A | Back alignment and structure |
|---|
| >2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* | Back alignment and structure |
|---|
| >3cx5_J Heavy chain (VH) of FV-fragment; complex III, electron transfer complex, cytochrome BC1 complex, mitochondrialtransmembrane complex; HET: M3L SUC 6PH UMQ HEM SMA 8PE 9PE CN5 7PH CN3; 1.90A {Mus musculus} SCOP: b.1.1.1 PDB: 1kb9_J* 1kyo_J* 1p84_J* 2ibz_X* 1ezv_X* 3cxh_J* | Back alignment and structure |
|---|
| >3sob_H Antibody heavy chain, low-density lipoprotein receptor-related protein; beta propeller, protein binding-immune system complex; 1.90A {Homo sapiens} PDB: 1pkq_B 3uls_H 3ulu_D* 3ulv_D* | Back alignment and structure |
|---|
| >3bdb_A Novel immune-type receptor 11; immunoglobulin variable domain-like beta-sandwich, stalk region, immune system; 2.80A {Ictalurus punctatus} | Back alignment and structure |
|---|
| >3moq_A NEW antigen receptor variable domain, P3(40) PEPT amyloid beta A4 protein; AB-ignar, AB-12Y-2, glycoprotein, membran protease inhibitor; 2.05A {Orectolobus maculatus} PDB: 2z8w_C 2z8v_C 1ves_A 1ver_A | Back alignment and structure |
|---|
| >3bj9_1 Immunoglobulin IOTA chain, immunoglobulin lambda- like polypeptide 1; immunoglobulin domain, beta sheet, polymorphism, immune system; 2.00A {Homo sapiens} PDB: 2h3n_A | Back alignment and structure |
|---|
| >2qhl_A Novel immune-type receptor 10; immunoglobulin variable domain-like beta-sandwich, immune system; 1.56A {Ictalurus punctatus} PDB: 3b5t_A 2qjd_A 2qte_A 2qqq_A | Back alignment and structure |
|---|
| >1mju_H Immunoglobulin MS6-12; catalytic antibody, ester hydrolysis, esterolytic, FAB, immune system; 1.22A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mjj_B 1mie_H 1mj7_H* 1mj8_H 1mh5_B* 4aeh_H 2y5t_A 2vwe_E 2op4_H 2ntf_H 3loh_C 1e4x_H 2vl5_A 1e4x_I 1e4w_H 3opz_H 3oz9_H 1plg_H 1hi6_B 1cfn_B ... | Back alignment and structure |
|---|
| >1igy_B IGG1 intact antibody MAB61.1.3; intact immunoglobulin, V region, C region, hinge region, immunoglobulin; HET: NAG FUL NDG BMA MAN GAL FUC; 3.20A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 | Back alignment and structure |
|---|
| >2wng_A Tyrosine-protein phosphatase non-receptor type substrate 1; signal regulatory protein alpha, immunoglobulin superfamily, phosphoprotein; HET: NAG; 2.49A {Homo sapiens} | Back alignment and structure |
|---|
| >1i3g_L Antibody FV fragment; antibiotic; 2.44A {Mus musculus} SCOP: b.1.1.1 PDB: 3iy6_A | Back alignment and structure |
|---|
| >1dlf_L Anti-dansyl immunoglobulin IGG2A(S); FV fragment; 1.45A {Mus musculus} SCOP: b.1.1.1 PDB: 1wz1_L* 2dlf_L 1maj_A 1mak_A 1ktr_L 2cju_L* 2uud_K* 1dsf_L 3nn8_B 1n4x_L 1bfv_L* 1cfv_L* 2bfv_L* 1wt5_C | Back alignment and structure |
|---|
| >2p45_B Antibody CAB-RN05; seMet phasing, camelid single-domain antibody, VHH, RNAse A, yeast surface display, hydrolase/immune system complex; 1.10A {Camelus dromedarius} PDB: 2p46_B 2p47_B 2p48_B 2p44_B 2p49_B 2p42_B 2p43_B 1bzq_K 3qsk_B 2p4a_B 1op9_A 1sjx_A 3qxt_A* 3qxu_A 3eba_A | Back alignment and structure |
|---|
| >3ux9_B SCFV antibody; five helices, long loop connecting helix, hydrophobic intera cytokine-immune system complex; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1oga_E TRBC1, T-cell receptor beta chain C region; immune system/receptor, immune system/receptor/complex, TCR, MHC, immunodominance, FLU, complex; 1.40A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 2vlm_E 2vlk_E 2vlj_E 2vlr_E 2xna_B 2xn9_B 2axh_A 2axj_A 3scm_D* 3sda_D* 3sdc_D* 3sdd_D* 3qi9_D* 3mff_B* 2ak4_E 3he7_D* 2eyr_B 3pqy_E 3kxf_E 2cde_B ... | Back alignment and structure |
|---|
| >1iga_A IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg_A 2qtj_A 3chn_A 1r70_B 3cm9_A | Back alignment and structure |
|---|
| >3u2s_H PG9 heavy chain; greek KEY, immunoglobulin, immune recognition, immune system; HET: PCA TYS BU3 NAG BMA MAN; 1.80A {Homo sapiens} PDB: 3u4e_H* 3u36_H 3mug_B* 3lrs_H* 3mme_H* 2qsc_H* | Back alignment and structure |
|---|
| >1yc7_A Anti-VSG immunoglobulin heavy chain variable domain caban33; antibody, camel antibody, immune system; 1.60A {Camelus dromedarius} PDB: 1yc8_A 1yzz_A | Back alignment and structure |
|---|
| >1svz_A Immunoglobulin;, single-chain FV fragment 1696; antibody-antigen complex, HIV inhibiting antibody; 1.89A {Mus musculus} PDB: 1jp5_A | Back alignment and structure |
|---|
| >2yz1_A Tyrosine-protein phosphatase non-receptor type substrate 1; beta-sandwich, structural genomics, NPPSFA; 1.40A {Mus musculus} | Back alignment and structure |
|---|
| >3tv3_H PGT128 heavy chain, IG gamma-1 chain C region; FAB, HIV-1 neutralizing antibody, GP120, immune system; HET: PCA MAN GOL EPE; 1.29A {Homo sapiens} PDB: 3tyg_H* 3twc_H* 3tje_H* 3thm_H* 4fqq_H 2xzc_H* 2xza_H* 3b2u_H* 3b2v_H* 3mly_H 3mlz_H 4fq2_H 2ykl_H* 3tnm_H 4fqc_H* 4fq1_H* 2yk1_H* 3mlx_H 2jix_D 2vxq_H ... | Back alignment and structure |
|---|
| >3mlr_H Human monoclonal anti-HIV-1 GP120 V3 antibody 255 heavy chain; human monoclonal antibody, FAB, third variable antibody-antigen interaction; 1.80A {Homo sapiens} PDB: 3mls_H 3mlt_H 3mlu_H 3mlv_H | Back alignment and structure |
|---|
| >1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >2wzp_D Camelid VHH5; baseplate, viral protein; 2.60A {Lama glama} PDB: 2bse_D | Back alignment and structure |
|---|
| >1kxt_B Immunoglobulin VHH fragment; alpha 8 beta 8, beta barrel, hydrolase, immune system; 2.00A {Camelus dromedarius} SCOP: b.1.1.1 | Back alignment and structure |
|---|
| >1i3u_A Antibody VHH LAMA domain; VHH fragment, immune system; HET: RR1; 1.95A {Lama glama} SCOP: b.1.1.1 PDB: 1i3v_A | Back alignment and structure |
|---|
| >1qfo_A Protein (sialoadhesin); immunoglobulin superfamily, carbohydrate binding, immune system; HET: SIA GAL GLC; 1.85A {Mus musculus} SCOP: b.1.1.1 PDB: 1od7_A* 1oda_A* 1od9_A* 1qfp_A 2bve_A* 1url_A* | Back alignment and structure |
|---|
| >1xiw_D Immunoglobulin heavy chain variable region; CD3-epsilon, CD3-delta, UCHT1-SCFV, immunoglobulin fold, antibody-antigen complex; 1.90A {Mus musculus} SCOP: b.1.1.1 PDB: 3iy3_B | Back alignment and structure |
|---|
| >2atp_B T-cell surface glycoprotein CD8 beta chain; CD8AB, CD8AA, MHC, immune system; HET: NAG; 2.40A {Mus musculus} SCOP: b.1.1.1 PDB: 3b9k_B* | Back alignment and structure |
|---|
| >1hxm_B Gamma-delta T-cell receptor; IG domain, TCR, GDTCR, immune system; 3.12A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 | Back alignment and structure |
|---|
| >1ypz_F T-cell receptor gamma chain, beta-2-microglobulin; H2-T22 protein, T cell receptor delta, immune system; HET: NAG MAN FUC; 3.40A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 | Back alignment and structure |
|---|
| >1zvh_A Immunoglobulin heavy chain antibody variable domain; beta sandwich, immunoglobulin fold, protein-protein heterocomplex; 1.50A {Camelus dromedarius} SCOP: b.1.1.1 PDB: 3dwt_A 1g6v_K 1zv5_A 1kxq_E | Back alignment and structure |
|---|
| >2z35_A T-cell receptor alpha-chain; immune receptor, immune system; 2.20A {Mus musculus} PDB: 2pxy_A 2z31_A 1ac6_A | Back alignment and structure |
|---|
| >3d9a_L Light chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_L 1xgp_A 1xgq_A 1xgr_A 1xgt_A 1dqq_A 1dqm_L 1dqj_A 1nby_A 1nbz_A 1ndg_A 1ndm_A 1xgu_A 1fh5_L 1bm3_L 1opg_L 1mlb_A 1mlc_A 1rih_L 1p2c_A ... | Back alignment and structure |
|---|
| >1hxm_A Gamma-delta T-cell receptor; IG domain, TCR, GDTCR, immune system; 3.12A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 | Back alignment and structure |
|---|
| >2frg_P TREM-like transcript-1; immunoglobulin-like, beta-sandwich, cell surface receptor, triggering receptor, platelet receptor, ITIM, immune system; 1.19A {Homo sapiens} | Back alignment and structure |
|---|
| >2x1q_A Gelsolin nanobody; contractIle protein; 1.06A {Lama glama} PDB: 2x1p_A 2xa3_A 3k7u_A 3sn6_N* 3stb_A 2x1o_A 3k80_A 1ol0_A 1u0q_A 1qd0_A* 3ezj_B 3p0g_B* 1mvf_A 1t2j_A | Back alignment and structure |
|---|
| >1smo_A Triggering receptor expressed on myeloid cells 1; activating receptors, TREM-1, innate immune system receptor, system; HET: TLA; 1.47A {Homo sapiens} SCOP: b.1.1.1 | Back alignment and structure |
|---|
| >2xt1_B Camelid VHH 9; viral protein-immune system complex; 1.32A {Vicugna pacos} PDB: 2xv6_B 2xxc_B 2xxm_B | Back alignment and structure |
|---|
| >2bnu_A TCR alpha chain, T-cell receptor alpha chain C region; superagonist peptide T-cell vaccines, transmembrane, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 2bnq_D 2bnr_D 2f54_D 2pyf_A* 2pye_D* 2f53_D 2p5e_D* 2p5w_D* 3mv7_D 3mv8_D 3mv9_D 3utt_D 2cdg_A | Back alignment and structure |
|---|
| >3vh8_G Killer cell immunoglobulin-like receptor 3DL1; immunoglobulin fold, natural killer cell receptor, immune SY; HET: NAG; 1.80A {Homo sapiens} PDB: 1im9_D | Back alignment and structure |
|---|
| >2gjj_A A21 single-chain antibody fragment against ERBB2; IG family, SCFV, immune system; 2.10A {Mus musculus} PDB: 3h3b_C | Back alignment and structure |
|---|
| >2otu_A FV light chain variable domain; antibody FV polyglutamine complex, immune system; 1.68A {Mus musculus} PDB: 2otw_A 2gsg_A | Back alignment and structure |
|---|
| >3iu4_H CHP3 FAB heavy chain; antibody, ganglioside, idiotype, immune system; 1.75A {Mus musculus} PDB: 1ibg_H* 3iy6_B | Back alignment and structure |
|---|
| >1mqk_H Antibody 7E2 FV fragment, heavy chain; membrane protein, cytochrome C oxidase, high- resolution structure, immune system; 1.28A {Mus musculus} SCOP: b.1.1.1 PDB: 1ar1_C 3ehb_C* 3hb3_C* 1qle_H* 2otu_B 2gsg_B 2otw_B 1qfw_I* 3ab0_B 1i8k_B 1i8i_B 1vhp_A 1bfv_H* 1cfv_H* 2bfv_H* 1dsf_H | Back alignment and structure |
|---|
| >1dr9_A B7-1 (CD80), T lymphocyte activation antigen; IG superfamily, immune system; HET: NAG; 3.00A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1i8l_A* | Back alignment and structure |
|---|
| >2aw2_A B and T lymphocyte attenuator; IGI domain, IGG domain, TNFRSF, protein-protein complex, IMM system; HET: NAG FUL; 2.80A {Homo sapiens} SCOP: b.1.1.1 | Back alignment and structure |
|---|
| >1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R | Back alignment and structure |
|---|
| >2gki_A Nuclease; anti-DNA antibody, catalytic antibody, immune system; 2.88A {Mus musculus} | Back alignment and structure |
|---|
| >1q9r_B S25-2 FAB (IGG1K) heavy chain; antigen-binding fragment, anti-carbohydrate, anti-LPS, antibody, immunoglobulin, KDO, complex, immune system; HET: KDA KDO; 1.45A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q9l_B 1q9k_B* 1q9q_B* 1q9v_B* 2r1w_B* 2r1x_B* 2r1y_B* 2r2b_B* 2r2e_B* 2r2h_B* 3bpc_B* 3sy0_B* 3t4y_B* 3t65_B* 2r23_B* 1q9t_B* 3t77_B* 3okl_B* 3okk_B* 3okm_B ... | Back alignment and structure |
|---|
| >3esu_F Antibody 14B7* light chain and antibody 14B7* heavy chain linked with A synthetic...; single-chain FV, monoclonal antibody, immunoglobulin; 1.30A {Mus musculus} PDB: 3et9_F 3esv_F 3etb_F 1h8n_A 1h8s_A* 1h8o_A* | Back alignment and structure |
|---|
| >2vol_A Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, cytoplasm, mouse IGG, zinc-finger, DNA-binding, RNA-binding, tripartite motif (TRIM) protein; HET: NAG MAN GAL FUC; 1.95A {Mus musculus} PDB: 3hkf_A 1i1a_C* 1cqk_A | Back alignment and structure |
|---|
| >2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* | Back alignment and structure |
|---|
| >3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2oi9_C V beta, T cell receptor beta chain; TCR, MHC, immune system; 2.35A {Mus musculus} PDB: 2e7l_C | Back alignment and structure |
|---|
| >2ol3_A BM3.3 T-cell receptor alpha-chain; T cell receptor, class I MHC, H-2KBM8, TCR-PMHC complex, IMM system; HET: NAG; 2.90A {Mus musculus} SCOP: b.1.1.1 | Back alignment and structure |
|---|
| >3noi_A Natural cytotoxicity triggering receptor 3; immune system, innate immunity, immunoglobulin-like I2 type natural killer cell activation; HET: 1PG; 1.84A {Homo sapiens} PDB: 3pv6_B* | Back alignment and structure |
|---|
| >3mj8_L Stimulatory hamster antibody HL4E10 FAB light CHA; hamster IGG, immune system; 2.94A {Cricetulus migratorius} PDB: 3mj9_L* | Back alignment and structure |
|---|
| >3k1k_C Enhancer; nanobody, antibody-complex, chromophore, luminescence, photoprotein, luminescent protein/immune system complex; HET: GYS; 2.15A {Lama pacos} SCOP: b.1.1.1 PDB: 3miq_E* 3ogo_E* | Back alignment and structure |
|---|
| >1qok_A MFE-23 recombinant antibody fragment; immunoglobulin, single-chain FV, anti-carcinoembryonic antigen; 2.4A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 | Back alignment and structure |
|---|
| >2i24_N NEW antigen receptor PBLA8; immunoglobulin fold, immune system; 1.35A {Ginglymostoma cirratum} PDB: 2i25_N 2i27_N 2i26_N | Back alignment and structure |
|---|
| >2ak4_D SB27 T cell receptor alpha chain; bulged epitopes, PMHC/TCR complex, immune system; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 3kxf_D 3nfj_I 3ffc_D | Back alignment and structure |
|---|
| >3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1rjc_A 1D2L19, camelid heavy chain antibody; beta sandwich, immunoglobulin fold, protein-protein hetero C alpha-beta orthogonal bundle, immune system-hydrolase compl; 1.40A {Camelus dromedarius} SCOP: b.1.1.1 PDB: 1ri8_A 1xfp_A 1jtt_A 2x6m_A 1zmy_A 1f2x_K | Back alignment and structure |
|---|
| >1zvy_A Immunoglobulin heavy chain antibody variable DOMA; beta sandwich, immunoglobulin fold, protein protein heteroco alpha-beta orthogonal bundle, hydrolase-immune system compl; 1.63A {Camelus dromedarius} SCOP: b.1.1.1 | Back alignment and structure |
|---|
| >3juy_B 3B3 single chain variant HIV-1 antibody; envelope protein GP120, broadly neutralizing antibody, 3B3 single chain variable fragment, immune system; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1nqb_A Single-chain antibody fragment; multivalent antibody, diabody, domain SWA immunoglobulin; 2.00A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 PDB: 1lmk_A 1qnz_H | Back alignment and structure |
|---|
| >1kgc_D T-cell receptor alpha chain; LC13 clone, immune system; 1.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1mi5_D 3kpr_D 3kps_D 3o6f_C 3t0e_C 3pqy_D 2esv_D 3dxa_D 3dx9_A | Back alignment and structure |
|---|
| >2gki_A Nuclease; anti-DNA antibody, catalytic antibody, immune system; 2.88A {Mus musculus} | Back alignment and structure |
|---|
| >3k74_B Nanobody; immunoglobulin, antibiotic resista methotrexate resistance, NADP, one-carbon metabolism, oxidoreductase, trimethoprim resistance; 1.95A {Lama glama} | Back alignment and structure |
|---|
| >3nn8_A Engineered SCFV, heavy chain; beta barrel, antibody fragment, immunoglobulin, immune syste; 3.10A {Mus musculus} | Back alignment and structure |
|---|
| >3lh2_H FV 4E10 heavy chain; epitope-scaffold, immune system; 2.65A {Homo sapiens} PDB: 3h3p_H 3lhp_H 2xtj_D | Back alignment and structure |
|---|
| >2hp4_A T-cell surface glycoprotein CD8 alpha chain; CO-receptor, soluble protein, KD, protein engineering, immunotherapy, immune-suppressor, immune system; 2.10A {Homo sapiens} PDB: 1akj_D 1cd8_A 3qzw_G 2q3a_A | Back alignment and structure |
|---|
| >1oga_D T-cell receptor alpha chain V region, beta-2-microglobulin; immune system/receptor, immune system/receptor/complex, TCR, MHC, immunodominance, FLU, complex; 1.40A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 2xna_A 2xn9_A 2vlm_D 2vlk_D 2vlj_D 2vlr_D 2cdf_A 2wbj_C* 3qdm_D 3qeq_D | Back alignment and structure |
|---|
| >2d7t_H Anti polyhydroxybutyrate antibody FV, heavy chain; plastic, immune system; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1dn0_B IGM-kappa cold agglutinin (heavy chain); FAB, antibody, human, immune system; 2.28A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1qlr_B* 2j6e_H* 2agj_H* 2h32_H | Back alignment and structure |
|---|
| >1moe_A Anti-CEA MAB T84.66; anti carcinoembryonic antigen, diabody, dimer, SCFV, variable domain, immune system; 2.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 | Back alignment and structure |
|---|
| >2yc1_B Single chain antibody fragment 9004G; immune system-toxin complex, scorpion toxin; 1.90A {Homo sapiens} PDB: 2ybr_B 3lh2_L 3h3p_L 3lhp_L | Back alignment and structure |
|---|
| >1lk3_L 9D7 light chain; antigen-antibody complex, immune system; 1.91A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 1fn4_A 1c5d_L 1bfo_A 3b9k_L* | Back alignment and structure |
|---|
| >3iy0_H FAB 14, heavy domain; cryoem, neutralizing antibody, parvovirus, canine, feline, FAB footprint, immune system; 12.50A {Mus musculus} | Back alignment and structure |
|---|
| >3omz_A Human vdelta1 gamma delta T cell receptor delta1A; immunoglobulin fold, immune surveillance of cell stress PROT A/B, MIC-A/B binding, epithelium; 3.04A {Homo sapiens} | Back alignment and structure |
|---|
| >2if7_A SLAM family member 6; NTB-A, homophilic receptor, immune system; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 98 | ||||
| d1biha4 | 89 | b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecr | 2e-06 | |
| d3dara1 | 97 | b.1.1.4 (A:153-249) Fibroblast growth factor recep | 3e-05 | |
| d2cqva1 | 101 | b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [T | 4e-05 | |
| d1gxea_ | 130 | b.1.1.4 (A:) Cardiac myosin binding protein C, dif | 5e-05 | |
| d2fdbp2 | 109 | b.1.1.4 (P:2252-2360) Fibroblast growth factor rec | 1e-04 | |
| d1rhfa1 | 91 | b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor | 2e-04 | |
| d1qz1a3 | 100 | b.1.1.4 (A:190-289) Neural cell adhesion molecule | 4e-04 | |
| d1koaa1 | 97 | b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorha | 4e-04 | |
| d2avga1 | 110 | b.1.1.4 (A:1-110) Cardiac myosin binding protein C | 5e-04 | |
| d1he7a_ | 107 | b.1.1.4 (A:) High affinity nerve growth factor rec | 6e-04 | |
| d1f97a2 | 110 | b.1.1.4 (A:129-238) Junction adhesion molecule, JA | 7e-04 | |
| d1cs6a3 | 91 | b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gall | 7e-04 | |
| d2dava1 | 113 | b.1.1.4 (A:8-120) Myosin-binding protein C, slow-t | 9e-04 | |
| d1x44a1 | 90 | b.1.1.4 (A:8-97) Myosin-binding protein C, slow-ty | 0.001 | |
| d1fhga_ | 102 | b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) | 0.001 | |
| d2c9aa1 | 96 | b.1.1.4 (A:184-279) Receptor-type tyrosine-protein | 0.001 | |
| d1tnna_ | 91 | b.1.1.4 (A:) Titin {Human (Homo sapiens), differen | 0.002 | |
| d1pkoa_ | 126 | b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein ( | 0.002 | |
| d1g1ca_ | 98 | b.1.1.4 (A:) Titin {Human (Homo sapiens), differen | 0.003 |
| >d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 89 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Immunoglobulin-like beta-sandwich superfamily: Immunoglobulin family: I set domains domain: Hemolin species: Moth (Hyalophora cecropia) [TaxId: 7123]
Score = 40.5 bits (94), Expect = 2e-06
Identities = 14/35 (40%), Positives = 19/35 (54%)
Query: 9 NVGLVIDSIGPGDEGEYTCCARNEFGEAICAVFIQ 43
+ GLVI + GD+G Y C A NE G+ +Q
Sbjct: 53 DSGLVIKGVKNGDKGYYGCRATNEHGDKYFETLVQ 87
|
| >d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 100 | Back information, alignment and structure |
|---|
| >d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 97 | Back information, alignment and structure |
|---|
| >d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 110 | Back information, alignment and structure |
|---|
| >d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 110 | Back information, alignment and structure |
|---|
| >d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 91 | Back information, alignment and structure |
|---|
| >d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 113 | Back information, alignment and structure |
|---|
| >d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 102 | Back information, alignment and structure |
|---|
| >d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 126 | Back information, alignment and structure |
|---|
| >d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 98 | |||
| d2cqva1 | 101 | Telokin {Human (Homo sapiens) [TaxId: 9606]} | 99.15 | |
| d1gxea_ | 130 | Cardiac myosin binding protein C, different domain | 99.04 | |
| d1koaa1 | 97 | Twitchin {Nematode (Caenorhabditis elegans) [TaxId | 98.97 | |
| d2dava1 | 113 | Myosin-binding protein C, slow-type {Human (Homo s | 98.97 | |
| d1wwca_ | 105 | NT3 binding domain of trkC receptor {Human (Homo s | 98.93 | |
| d1g1ca_ | 98 | Titin {Human (Homo sapiens), different modules [Ta | 98.92 | |
| d1fhga_ | 102 | Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103 | 98.9 | |
| d2avga1 | 110 | Cardiac myosin binding protein C, different domain | 98.89 | |
| d1wiua_ | 93 | Twitchin {Nematode (Caenorhabditis elegans) [TaxId | 98.85 | |
| d1tnna_ | 91 | Titin {Human (Homo sapiens), different modules [Ta | 98.83 | |
| d2fdbp2 | 109 | Fibroblast growth factor receptor, FGFR {Human (Ho | 98.82 | |
| d1cs6a3 | 91 | Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | 98.81 | |
| d1wwbx_ | 103 | Ligand binding domain of trkB receptor {Human (Hom | 98.78 | |
| d3b5ha1 | 101 | Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 | 98.77 | |
| d1gl4b_ | 89 | Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: | 98.77 | |
| d1he7a_ | 107 | High affinity nerve growth factor receptor TrkA, d | 98.76 | |
| d2c9aa1 | 96 | Receptor-type tyrosine-protein phosphatase mu {Hum | 98.76 | |
| d1qz1a3 | 100 | Neural cell adhesion molecule (NCAM) {Rat (Rattus | 98.74 | |
| d3dara1 | 97 | Fibroblast growth factor receptor, FGFR {Human (Ho | 98.74 | |
| d2nxyb2 | 84 | CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9 | 98.73 | |
| d1gsma1 | 90 | Mucosal addressin cell adhesion molecule-1 (MADCAM | 98.72 | |
| d1cs6a4 | 89 | Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | 98.71 | |
| d1rhfa1 | 91 | Tyrosine-protein kinase receptor tyro3, N-terminal | 98.69 | |
| d1biha4 | 89 | Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | 98.68 | |
| d1vcaa2 | 90 | Vascular cell adhesion molecule-1 (VCAM-1) {Human | 98.67 | |
| d2crya1 | 115 | Kin of IRRE-like protein 3, KIRREL3 {Human (Homo s | 98.6 | |
| d1biha3 | 97 | Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | 98.57 | |
| d1pkoa_ | 126 | Myelin oligodendrocyte glycoprotein (MOG) {Rat (Ra | 98.57 | |
| d1epfa1 | 97 | Neural cell adhesion molecule (NCAM) {Rat (Rattus | 98.53 | |
| d2aw2a1 | 104 | B- and T-lymphocyte attenuator CD272 {Human (Homo | 98.52 | |
| d1f97a2 | 110 | Junction adhesion molecule, JAM, C-terminal domain | 98.51 | |
| d1iray1 | 101 | Type-1 interleukin-1 receptor {Human (Homo sapiens | 98.45 | |
| d1f97a1 | 102 | Junction adhesion molecule, JAM, N-terminal domain | 98.43 | |
| d1x44a1 | 90 | Myosin-binding protein C, slow-type {Human (Homo s | 98.42 | |
| d2ifga1 | 92 | High affinity nerve growth factor receptor TrkA, d | 98.42 | |
| d1iray3 | 107 | Type-1 interleukin-1 receptor {Human (Homo sapiens | 98.41 | |
| d1l6za2 | 96 | Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-t | 98.41 | |
| d1nbqa2 | 104 | Junction adhesion molecule, JAM, C-terminal domain | 98.39 | |
| d1nbqa1 | 105 | Junction adhesion molecule, JAM, N-terminal domain | 98.39 | |
| d2oz4a3 | 84 | Intercellular adhesion molecule-1, ICAM-1 {Human ( | 98.34 | |
| d1pd6a_ | 94 | Cardiac myosin binding protein C, different domain | 98.31 | |
| d1olza1 | 92 | Semaphorin 4d Ig-like domain {Human (Homo sapiens) | 98.29 | |
| d1epfa2 | 92 | Neural cell adhesion molecule (NCAM) {Rat (Rattus | 98.29 | |
| d2fcba2 | 88 | Fc gamma receptor ectodomain (CD32) {Human (Homo s | 98.29 | |
| d1cs6a2 | 105 | Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | 98.28 | |
| d1tiua_ | 89 | Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxI | 98.23 | |
| d1biha1 | 94 | Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | 98.23 | |
| d1f2qa2 | 89 | IgE high affinity receptor alpha subunit {Human (H | 98.23 | |
| d1iray2 | 103 | Type-1 interleukin-1 receptor {Human (Homo sapiens | 98.21 | |
| d1eaja_ | 124 | Coxsackie virus and adenovirus receptor (Car), dom | 98.2 | |
| d1hnga1 | 98 | CD2, first domain {Rat (Rattus norvegicus) [TaxId: | 98.18 | |
| d1ccza1 | 93 | CD2-binding domain of CD58, N-terminal domain {Hum | 98.16 | |
| d1fnla2 | 89 | Fc gamma receptor ectodomain (CD32) {Human (Homo s | 98.1 | |
| d1cs6a1 | 97 | Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | 98.09 | |
| d1iama1 | 103 | Intercellular cell adhesion molecule-1 (ICAM-1) {H | 98.0 | |
| d1rhfa2 | 85 | Tyrosine-protein kinase receptor tyro3, second dom | 97.93 | |
| d1neua_ | 119 | Myelin membrane adhesion molecule P0 {Rat (Rattus | 97.93 | |
| d1xeda_ | 116 | Polymeric-immunoglobulin receptor, PIGR {Human (Ho | 97.79 | |
| d1n26a1 | 93 | Interleukin-6 receptor alpha chain, N-terminal dom | 97.73 | |
| d1f2qa1 | 82 | IgE high affinity receptor alpha subunit {Human (H | 97.7 | |
| d1fnla1 | 84 | Fc gamma receptor ectodomain (CD32) {Human (Homo s | 97.67 | |
| d1biha2 | 111 | Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | 97.67 | |
| d1l6za1 | 107 | Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-t | 97.62 | |
| d2nxyb1 | 97 | CD4 V-set domains {Human (Homo sapiens) [TaxId: 96 | 97.55 | |
| d2fcba1 | 85 | Fc gamma receptor ectodomain (CD32) {Human (Homo s | 97.55 | |
| d1dr9a1 | 105 | CD80, N-terminal domain {Human (Homo sapiens) [Tax | 97.51 | |
| d1hkfa_ | 108 | NK cell activating receptor NKP44 {Human (Homo sap | 97.44 | |
| d1ncna_ | 110 | CD86 (b7-2), N-terminal domain {Human (Homo sapien | 97.34 | |
| d1zxqa1 | 106 | Intercellular cell adhesion molecule-2 (ICAM-2) {H | 97.27 | |
| d1qfoa_ | 118 | N-terminal domain of sialoadhesin {Mouse (Mus musc | 97.25 | |
| d2g5ra1 | 121 | N-terminal domain of sialic acid binding Ig-like l | 96.9 | |
| d1tvda_ | 116 | T-cell antigen receptor {Human (Homo sapiens), del | 96.81 | |
| d2ak4d1 | 114 | T-cell antigen receptor {Human (Homo sapiens), alp | 96.8 | |
| d2gj6d1 | 94 | T-cell antigen receptor {Mouse (Mus musculus), bet | 96.78 | |
| d2cdea1 | 114 | T-cell antigen receptor {Human (Homo sapiens), bet | 96.66 | |
| d3bp5a1 | 114 | Programmed cell death protein 1, PD1, extracellula | 96.59 | |
| d1smoa_ | 113 | TREM-1 (triggering receptor expressed on myeloid c | 96.51 | |
| d1nezg_ | 122 | CD8 {Mouse (Mus musculus) [TaxId: 10090]} | 96.44 | |
| d1a0ql1 | 106 | Immunoglobulin light chain kappa variable domain, | 96.43 | |
| d1fo0a_ | 115 | T-cell antigen receptor {Mouse (Mus musculus), alp | 96.4 | |
| d2bnqd1 | 113 | T-cell antigen receptor {Human (Homo sapiens), alp | 96.39 | |
| d1q9ra1 | 113 | Immunoglobulin light chain kappa variable domain, | 96.35 | |
| d1sq2n_ | 112 | Novel antigen receptor (against lysozyme) {Nurse s | 96.33 | |
| d1ogad1 | 115 | T-cell antigen receptor {Human (Homo sapiens), alp | 96.28 | |
| d1lp9e1 | 115 | T-cell antigen receptor {Mouse (Mus musculus), alp | 96.26 | |
| d1vesa_ | 113 | Novel antigen receptor 12Y-2 {Spotted wobbegong (O | 96.25 | |
| d1u3ha1 | 110 | T-cell antigen receptor {Mouse (Mus musculus), alp | 96.22 | |
| d1ymmd1 | 96 | T-cell antigen receptor {Human (Homo sapiens), alp | 96.17 | |
| d1yqvl1 | 104 | Immunoglobulin light chain kappa variable domain, | 96.12 | |
| d2atpb1 | 115 | CD8 {Mouse (Mus musculus), beta-chain [TaxId: 1009 | 96.11 | |
| d1akjd_ | 114 | CD8 {Human (Homo sapiens) [TaxId: 9606]} | 96.07 | |
| d1bd2d1 | 111 | T-cell antigen receptor {Human (Homo sapiens), alp | 96.05 | |
| d2esvd1 | 110 | T-cell antigen receptor {Human (Homo sapiens), alp | 96.03 | |
| d1c5cl1 | 107 | Immunoglobulin light chain kappa variable domain, | 96.01 | |
| d1i8ka_ | 106 | Immunoglobulin light chain kappa variable domain, | 96.0 | |
| d1yjdc1 | 118 | CD28 {Human (Homo sapiens) [TaxId: 9606]} | 95.93 | |
| d1jhll_ | 108 | Immunoglobulin light chain kappa variable domain, | 95.93 | |
| d1h5ba_ | 113 | T-cell antigen receptor {Mouse (Mus musculus), alp | 95.91 | |
| d1ucta1 | 99 | Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa | 95.91 | |
| d1cd0a_ | 111 | Immunoglobulin light chain lambda variable domain, | 95.87 | |
| d1olla1 | 95 | Ligand binding domain of NK receptor NKp46 {Human | 95.81 | |
| d1j1pl_ | 107 | Immunoglobulin light chain kappa variable domain, | 95.8 | |
| d1i9ea_ | 115 | T-cell antigen receptor {Mouse (Mus musculus), alp | 95.78 | |
| d1j05a_ | 111 | Immunoglobulin light chain kappa variable domain, | 95.77 | |
| d1tjgl1 | 107 | Immunoglobulin light chain kappa variable domain, | 95.64 | |
| d1ospl1 | 107 | Immunoglobulin light chain kappa variable domain, | 95.62 | |
| d1lgva1 | 112 | Immunoglobulin light chain lambda variable domain, | 95.6 | |
| d1ypzf1 | 120 | T-cell antigen receptor {Human (Homo sapiens), gam | 95.58 | |
| d1kgce1 | 112 | T-cell antigen receptor {Human (Homo sapiens), bet | 95.57 | |
| d1dqta_ | 117 | Immunoreceptor CTLA-4 (CD152), N-terminal fragment | 95.57 | |
| d1j8hd1 | 115 | T-cell antigen receptor {Human (Homo sapiens), alp | 95.5 | |
| d2ntsp1 | 113 | T-cell antigen receptor {Human (Homo sapiens), bet | 95.45 | |
| d1i8lc_ | 118 | Immunoreceptor CTLA-4 (CD152), N-terminal fragment | 95.37 | |
| d1mexl1 | 107 | Immunoglobulin light chain kappa variable domain, | 95.32 | |
| d1hxma1 | 120 | T-cell antigen receptor {Human (Homo sapiens), gam | 95.32 | |
| d1kcvl1 | 107 | Immunoglobulin light chain kappa variable domain, | 95.3 | |
| d2fx7l1 | 108 | Immunoglobulin light chain kappa variable domain, | 95.28 | |
| d1lk3l1 | 106 | Immunoglobulin light chain kappa variable domain, | 95.27 | |
| d1op3k1 | 106 | Immunoglobulin light chain kappa variable domain, | 95.27 | |
| d3cx5k1 | 107 | Immunoglobulin light chain kappa variable domain, | 95.27 | |
| d8faba1 | 103 | Immunoglobulin light chain lambda variable domain, | 95.26 | |
| d1u9ka_ | 110 | TREM-1 (triggering receptor expressed on myeloid c | 95.22 | |
| d1mqkl_ | 109 | Immunoglobulin light chain kappa variable domain, | 95.22 | |
| d1fltx_ | 95 | Second domain of the Flt-1 receptor {Human (Homo s | 95.15 | |
| d1ogae1 | 114 | T-cell antigen receptor {Human (Homo sapiens), bet | 95.15 | |
| d1j8he1 | 113 | T-cell antigen receptor {Human (Homo sapiens), bet | 95.11 | |
| d2esve1 | 111 | T-cell antigen receptor {Human (Homo sapiens), bet | 95.09 | |
| d1rzfl1 | 111 | Immunoglobulin light chain lambda variable domain, | 95.01 | |
| d2ij0c1 | 118 | T-cell antigen receptor {Human (Homo sapiens), bet | 95.01 | |
| d1d5il1 | 107 | Immunoglobulin light chain kappa variable domain, | 94.99 | |
| d2aq2a1 | 110 | T-cell antigen receptor {Mouse (Mus musculus), bet | 94.98 | |
| d1hxmb1 | 123 | T-cell antigen receptor {Human (Homo sapiens), del | 94.92 | |
| d1n4xl_ | 113 | Immunoglobulin light chain kappa variable domain, | 94.92 | |
| d2rhea_ | 114 | Immunoglobulin light chain lambda variable domain, | 94.86 | |
| d1mjul1 | 112 | Immunoglobulin light chain kappa variable domain, | 94.75 | |
| d1f3rb2 | 119 | Immunoglobulin light chain kappa variable domain, | 94.59 | |
| d1ncwl1 | 112 | Immunoglobulin light chain kappa variable domain, | 94.55 | |
| d1kgcd1 | 112 | T-cell antigen receptor {Human (Homo sapiens), alp | 94.53 | |
| d1bwwa_ | 109 | Immunoglobulin light chain kappa variable domain, | 94.52 | |
| d2cdeb1 | 112 | T-cell antigen receptor {Human (Homo sapiens), bet | 94.45 | |
| d2gsia1 | 111 | Immunoglobulin light chain kappa variable domain, | 94.37 | |
| d1ac6a_ | 110 | T-cell antigen receptor {Mouse (Mus musculus), alp | 94.34 | |
| d2agjh1 | 120 | Immunoglobulin heavy chain variable domain, VH {En | 94.3 | |
| d1w72l1 | 109 | Immunoglobulin light chain lambda variable domain, | 94.17 | |
| d1nfdb1 | 113 | T-cell antigen receptor {Mouse (Mus musculus), bet | 94.05 | |
| d1oaql_ | 110 | Immunoglobulin light chain lambda variable domain, | 94.02 | |
| d1cfba1 | 100 | Neuroglian, two amino proximal Fn3 repeats {Drosop | 93.94 | |
| d1nfde1 | 108 | Immunoglobulin light chain lambda variable domain, | 93.68 | |
| d2bnub1 | 112 | T-cell antigen receptor {Human (Homo sapiens), bet | 93.51 | |
| d1oari_ | 103 | Immunoglobulin heavy chain variable domain, VH {Ra | 93.41 | |
| d1eapb1 | 119 | Immunoglobulin heavy chain variable domain, VH {Mo | 93.24 | |
| d1dn0b1 | 120 | Immunoglobulin heavy chain variable domain, VH {Hu | 93.07 | |
| d1xaua_ | 104 | B and T lymphocyte attenuator, Btla {Mouse (Mus mu | 93.01 | |
| d1ugna2 | 98 | Ligand binding domain of lir-1 (ilt2) {Human (Homo | 92.68 | |
| d1kxvc_ | 119 | Camelid IG heavy chain variable domain, VHh {Camel | 92.58 | |
| d1etzb1 | 126 | Immunoglobulin heavy chain variable domain, VH {Mo | 92.57 | |
| d1fn4b1 | 116 | Immunoglobulin heavy chain variable domain, VH {Ra | 92.19 | |
| d1rz7h1 | 119 | Immunoglobulin heavy chain variable domain, VH {Hu | 92.04 | |
| d1dfbh1 | 126 | Immunoglobulin heavy chain variable domain, VH {Hu | 91.84 | |
| d1iqdb1 | 117 | Immunoglobulin heavy chain variable domain, VH {Hu | 91.74 | |
| d7fabh1 | 116 | Immunoglobulin heavy chain variable domain, VH {Hu | 91.69 | |
| d1ol0a_ | 121 | Immunoglobulin heavy chain variable domain, VH {En | 91.69 | |
| d2fbjh1 | 118 | Immunoglobulin heavy chain variable domain, VH {Mo | 91.67 | |
| d1ai1h1 | 120 | Immunoglobulin heavy chain variable domain, VH {Mo | 91.63 | |
| d1c5db1 | 117 | Immunoglobulin heavy chain variable domain, VH {Ra | 91.58 | |
| d1i3ua_ | 127 | Camelid IG heavy chain variable domain, VHh {Llama | 91.5 | |
| d1sjva_ | 107 | Camelid IG heavy chain variable domain, VHh {Llama | 91.47 | |
| d1zvya1 | 124 | Camelid IG heavy chain variable domain, VHh {Camel | 91.42 | |
| d2fb4h1 | 127 | Immunoglobulin heavy chain variable domain, VH {Hu | 91.36 | |
| d2ck0h1 | 109 | Immunoglobulin heavy chain variable domain, VH {Mo | 91.35 | |
| d1vgeh1 | 122 | Immunoglobulin heavy chain variable domain, VH {Hu | 91.3 | |
| d1a2yb_ | 116 | Immunoglobulin heavy chain variable domain, VH {Mo | 91.3 | |
| d1ugna1 | 96 | Ligand binding domain of lir-1 (ilt2) {Human (Homo | 91.22 | |
| d1jpth1 | 117 | Immunoglobulin heavy chain variable domain, VH {En | 91.21 | |
| d1mfah1 | 117 | Immunoglobulin heavy chain variable domain, VH {Mo | 91.05 | |
| d1olla2 | 93 | Ligand binding domain of NK receptor NKp46 {Human | 91.03 | |
| d2vkwa2 | 93 | Neural cell adhesion molecule 1, NCAM {Human (Homo | 90.97 | |
| d1f3dh1 | 115 | Immunoglobulin heavy chain variable domain, VH {Mo | 90.95 | |
| d1jnhb1 | 117 | Immunoglobulin heavy chain variable domain, VH {Mo | 90.93 | |
| d1q9rb1 | 122 | Immunoglobulin heavy chain variable domain, VH {Mo | 90.89 | |
| d1tjgh1 | 132 | Immunoglobulin heavy chain variable domain, VH {En | 90.84 | |
| d3cx5j1 | 127 | Immunoglobulin heavy chain variable domain, VH {Mo | 90.8 | |
| d1hnfa1 | 101 | CD2, first domain {Human (Homo sapiens) [TaxId: 96 | 90.78 | |
| d1nkra1 | 96 | Killer cell inhibitory receptor {Human (Homo sapie | 90.76 | |
| d1ucta2 | 96 | Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa | 90.74 | |
| d1r0ah1 | 123 | Immunoglobulin heavy chain variable domain, VH {Mo | 90.69 | |
| d1bz7b1 | 122 | Immunoglobulin heavy chain variable domain, VH {Mo | 90.66 | |
| d1pg7x1 | 120 | Immunoglobulin heavy chain variable domain, VH {Mo | 90.64 | |
| d2jelh1 | 118 | Immunoglobulin heavy chain variable domain, VH {Mo | 90.63 | |
| d1um5h1 | 117 | Immunoglobulin heavy chain variable domain, VH {Mo | 90.59 | |
| d1mqkh_ | 123 | Immunoglobulin heavy chain variable domain, VH {Mo | 90.55 | |
| d1qnzh_ | 119 | Immunoglobulin heavy chain variable domain, VH {Mo | 90.47 | |
| d1nlbh1 | 118 | Immunoglobulin heavy chain variable domain, VH {Mo | 90.45 | |
| d1indh1 | 114 | Immunoglobulin heavy chain variable domain, VH {Mo | 90.4 | |
| d1wf5a1 | 108 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 90.15 | |
| d1ncwh1 | 119 | Immunoglobulin heavy chain variable domain, VH {Mo | 90.09 | |
| d1rjca1 | 126 | Camelid IG heavy chain variable domain, VHh {Camel | 90.03 | |
| d1vcaa1 | 109 | Vascular cell adhesion molecule-1 (VCAM-1) {Human | 89.92 | |
| d1j05b_ | 121 | Immunoglobulin heavy chain variable domain, VH {Mo | 89.9 | |
| d1lmka1 | 126 | Immunoglobulin heavy chain variable domain, VH {Mo | 89.81 | |
| d1dlfh_ | 120 | Immunoglobulin heavy chain variable domain, VH {Mo | 89.81 | |
| d1op3h1 | 125 | Immunoglobulin heavy chain variable domain, VH {En | 89.8 | |
| d2nxyd1 | 128 | Immunoglobulin heavy chain variable domain, VH {Hu | 89.75 | |
| d2fx7h1 | 127 | Immunoglobulin heavy chain variable domain, VH {Hu | 89.66 | |
| d1rihh1 | 125 | Immunoglobulin heavy chain variable domain, VH {Mo | 89.61 | |
| d1rzga1 | 130 | Immunoglobulin heavy chain variable domain, VH {Hu | 89.58 | |
| d1rhhb1 | 130 | Immunoglobulin heavy chain variable domain, VH {Hu | 89.55 | |
| d1mjuh1 | 116 | Immunoglobulin heavy chain variable domain, VH {Mo | 89.4 | |
| d1nfdf1 | 121 | Immunoglobulin heavy chain variable domain, VH {Ha | 89.39 | |
| d1ct8b1 | 118 | Immunoglobulin heavy chain variable domain, VH {Mo | 89.1 | |
| d3c2ah1 | 131 | Immunoglobulin heavy chain variable domain, VH {Hu | 89.01 | |
| d1rzfh1 | 133 | Immunoglobulin heavy chain variable domain, VH {Hu | 88.98 | |
| d1yedb1 | 124 | Immunoglobulin heavy chain variable domain, VH {Mo | 88.94 | |
| d1b2wh1 | 117 | Immunoglobulin heavy chain variable domain, VH {En | 88.83 | |
| d2p49b1 | 121 | Camelid IG heavy chain variable domain, VHh {Camel | 88.8 | |
| d2b1hh1 | 124 | Immunoglobulin heavy chain variable domain, VH {En | 88.57 | |
| d1n0xh1 | 127 | Immunoglobulin heavy chain variable domain, VH {Hu | 88.44 | |
| d1wisa1 | 111 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 88.43 | |
| d1uema_ | 117 | KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 | 88.33 | |
| d1ad9b1 | 120 | Immunoglobulin heavy chain variable domain, VH {En | 88.3 | |
| d1ieha_ | 135 | Camelid IG heavy chain variable domain, VHh {Llama | 88.14 | |
| d1lo4h1 | 118 | Immunoglobulin heavy chain variable domain, VH {Mo | 87.33 | |
| d1nkra2 | 99 | Killer cell inhibitory receptor {Human (Homo sapie | 86.48 | |
| d1x5za1 | 102 | Receptor-type tyrosine-protein phosphatase delta, | 85.77 | |
| d3d85d1 | 87 | The p40 domain of interleukin-12 (IL-12 beta chain | 85.75 | |
| d1x4za1 | 108 | Brother of CDO precursor (BOC) {Mouse (Mus musculu | 84.8 | |
| d1x5ya1 | 98 | Myosin binding protein C, fast-type {Mouse (Mus mu | 84.32 | |
| d1x3da1 | 105 | Fibronectin type-III domain containing protein 3a, | 82.59 | |
| d2ic2a1 | 107 | Hedgehog receptor iHog {Fruit fly (Drosophila mela | 81.66 | |
| d3b5ha2 | 80 | Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 | 80.13 |
| >d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Immunoglobulin-like beta-sandwich superfamily: Immunoglobulin family: I set domains domain: Telokin species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.15 E-value=4.5e-11 Score=73.14 Aligned_cols=47 Identities=19% Similarity=0.113 Sum_probs=42.9
Q ss_pred CCCeEEEEEcCCCCCCCeeEEEEEeCCCCceEEEEEEEEeecCCChh
Q psy2158 6 QSGNVGLVIDSIGPGDEGEYTCCARNEFGEAICAVFIQPECVNVPLY 52 (98)
Q Consensus 6 ~~g~~~L~I~~v~~~D~G~YtC~A~N~~G~~~~s~~L~V~~~p~p~~ 52 (98)
..+.+.|.|.++..+|+|.|+|.|.|.+|.+.+++.|.|.+.|.||.
T Consensus 52 ~~~~~~L~I~~~~~~D~G~Y~C~a~N~~G~~~~~~~l~V~~~P~pP~ 98 (101)
T d2cqva1 52 SENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPA 98 (101)
T ss_dssp CSSEEEEEETTCCTTTCEEEEEEEECSSCEEECCEEEEEECSCSCCC
T ss_pred ecceeEEEEeeCCcccCEEEEEEEEECCCEEEEEEEEEEEecCCCcC
Confidence 44667899999999999999999999999999999999999988763
|
| >d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} | Back information, alignment and structure |
|---|
| >d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nxyb2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gsma1 b.1.1.4 (A:1-90) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | Back information, alignment and structure |
|---|
| >d1vcaa2 b.1.1.4 (A:1-90) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | Back information, alignment and structure |
|---|
| >d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1epfa1 b.1.1.4 (A:1-97) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l6za2 b.1.1.4 (A:108-203) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nbqa1 b.1.1.1 (A:25-129) Junction adhesion molecule, JAM, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1olza1 b.1.1.4 (A:537-628) Semaphorin 4d Ig-like domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2fcba2 b.1.1.4 (A:91-178) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cs6a2 b.1.1.4 (A:104-208) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1tiua_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | Back information, alignment and structure |
|---|
| >d1f2qa2 b.1.1.4 (A:86-174) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iray2 b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eaja_ b.1.1.1 (A:) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hnga1 b.1.1.1 (A:2-99) CD2, first domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ccza1 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnla2 b.1.1.4 (A:87-175) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rhfa2 b.1.1.4 (A:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1neua_ b.1.1.1 (A:) Myelin membrane adhesion molecule P0 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xeda_ b.1.1.1 (A:) Polymeric-immunoglobulin receptor, PIGR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f2qa1 b.1.1.4 (A:4-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnla1 b.1.1.4 (A:3-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1biha2 b.1.1.4 (A:99-209) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | Back information, alignment and structure |
|---|
| >d1l6za1 b.1.1.1 (A:1-107) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2nxyb1 b.1.1.1 (B:1001-1097) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fcba1 b.1.1.4 (A:6-90) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dr9a1 b.1.1.1 (A:1-105) CD80, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hkfa_ b.1.1.1 (A:) NK cell activating receptor NKP44 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ncna_ b.1.1.1 (A:) CD86 (b7-2), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zxqa1 b.1.1.3 (A:87-192) Intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qfoa_ b.1.1.1 (A:) N-terminal domain of sialoadhesin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2g5ra1 b.1.1.1 (A:24-144) N-terminal domain of sialic acid binding Ig-like lectin 7 (SIGLEC-7, p75/AIRM1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tvda_ b.1.1.1 (A:) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ak4d1 b.1.1.1 (D:1-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gj6d1 b.1.1.1 (D:15-114) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cdea1 b.1.1.1 (A:2-115) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bp5a1 b.1.1.1 (A:1-114) Programmed cell death protein 1, PD1, extracellular domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1smoa_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nezg_ b.1.1.1 (G:) CD8 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a0ql1 b.1.1.1 (L:2-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fo0a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bnqd1 b.1.1.1 (D:2-114) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q9ra1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sq2n_ b.1.1.1 (N:) Novel antigen receptor (against lysozyme) {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]} | Back information, alignment and structure |
|---|
| >d1ogad1 b.1.1.1 (D:3-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lp9e1 b.1.1.1 (E:0-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vesa_ b.1.1.1 (A:) Novel antigen receptor 12Y-2 {Spotted wobbegong (Orectolobus maculatus) [TaxId: 168098]} | Back information, alignment and structure |
|---|
| >d1u3ha1 b.1.1.1 (A:2-116) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ymmd1 b.1.1.1 (D:9-104) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yqvl1 b.1.1.1 (L:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2atpb1 b.1.1.1 (B:1-115) CD8 {Mouse (Mus musculus), beta-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1akjd_ b.1.1.1 (D:) CD8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bd2d1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2esvd1 b.1.1.1 (D:4-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c5cl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1i8ka_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1yjdc1 b.1.1.1 (C:1-118) CD28 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jhll_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1h5ba_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ucta1 b.1.1.4 (A:2-100) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cd0a_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1olla1 b.1.1.4 (A:1-95) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j1pl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1i9ea_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1j05a_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tjgl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} | Back information, alignment and structure |
|---|
| >d1ospl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lgva1 b.1.1.1 (A:1-112) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 4 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ypzf1 b.1.1.1 (F:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kgce1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dqta_ b.1.1.1 (A:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1j8hd1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ntsp1 b.1.1.1 (P:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i8lc_ b.1.1.1 (C:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mexl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hxma1 b.1.1.1 (A:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kcvl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fx7l1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lk3l1 b.1.1.1 (L:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1op3k1 b.1.1.1 (K:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} | Back information, alignment and structure |
|---|
| >d3cx5k1 b.1.1.1 (K:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d8faba1 b.1.1.1 (A:3-105) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u9ka_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mqkl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fltx_ b.1.1.4 (X:) Second domain of the Flt-1 receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogae1 b.1.1.1 (E:5-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j8he1 b.1.1.1 (E:2-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2esve1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rzfl1 b.1.1.1 (L:2-108) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ij0c1 b.1.1.1 (C:1-117) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d5il1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2aq2a1 b.1.1.1 (A:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hxmb1 b.1.1.1 (B:1-123) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n4xl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2rhea_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mjul1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1f3rb2 b.1.1.1 (B:139-257) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ncwl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kgcd1 b.1.1.1 (D:2-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bwwa_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cdeb1 b.1.1.1 (B:5-116) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gsia1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ac6a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2agjh1 b.1.1.1 (H:1-120) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} | Back information, alignment and structure |
|---|
| >d1w72l1 b.1.1.1 (L:1-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nfdb1 b.1.1.1 (B:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1oaql_ b.1.1.1 (L:) Immunoglobulin light chain lambda variable domain, VL-lambda {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1nfde1 b.1.1.1 (E:2-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d2bnub1 b.1.1.1 (B:2-113) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oari_ b.1.1.1 (I:) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1eapb1 b.1.1.1 (B:1-124) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1dn0b1 b.1.1.1 (B:1-120) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 2.1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xaua_ b.1.1.4 (A:) B and T lymphocyte attenuator, Btla {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ugna2 b.1.1.4 (A:98-195) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kxvc_ b.1.1.1 (C:) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} | Back information, alignment and structure |
|---|
| >d1etzb1 b.1.1.1 (B:1-126) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fn4b1 b.1.1.1 (B:1-106) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1rz7h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dfbh1 b.1.1.1 (H:1-126) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iqdb1 b.1.1.1 (B:1-114) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d7fabh1 b.1.1.1 (H:1-116) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 2.1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ol0a_ b.1.1.1 (A:) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} | Back information, alignment and structure |
|---|
| >d2fbjh1 b.1.1.1 (H:1-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ai1h1 b.1.1.1 (H:1-112) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1c5db1 b.1.1.1 (B:1-117) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1i3ua_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]} | Back information, alignment and structure |
|---|
| >d1sjva_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]} | Back information, alignment and structure |
|---|
| >d1zvya1 b.1.1.1 (A:2-125) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} | Back information, alignment and structure |
|---|
| >d2fb4h1 b.1.1.1 (H:1-119) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ck0h1 b.1.1.1 (H:1-106) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vgeh1 b.1.1.1 (H:1-122) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a2yb_ b.1.1.1 (B:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 5 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ugna1 b.1.1.4 (A:2-97) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jpth1 b.1.1.1 (H:1-117) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} | Back information, alignment and structure |
|---|
| >d1mfah1 b.1.1.1 (H:251-367) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1olla2 b.1.1.4 (A:96-188) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f3dh1 b.1.1.1 (H:1-121) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jnhb1 b.1.1.1 (B:1-117) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1q9rb1 b.1.1.1 (B:1-111) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tjgh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} | Back information, alignment and structure |
|---|
| >d3cx5j1 b.1.1.1 (J:1-127) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hnfa1 b.1.1.1 (A:4-104) CD2, first domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nkra1 b.1.1.4 (A:6-101) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ucta2 b.1.1.4 (A:101-196) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r0ah1 b.1.1.1 (H:1-123) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bz7b1 b.1.1.1 (B:1-122) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1pg7x1 b.1.1.1 (X:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2jelh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1um5h1 b.1.1.1 (H:3-119) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mqkh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qnzh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nlbh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1indh1 b.1.1.1 (H:1-114) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ncwh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rjca1 b.1.1.1 (A:2-127) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} | Back information, alignment and structure |
|---|
| >d1vcaa1 b.1.1.3 (A:91-199) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j05b_ b.1.1.1 (B:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lmka1 b.1.1.1 (A:2-127) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1dlfh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1op3h1 b.1.1.1 (H:1-115) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} | Back information, alignment and structure |
|---|
| >d2nxyd1 b.1.1.1 (D:3001-3128) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fx7h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rihh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rzga1 b.1.1.1 (A:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rhhb1 b.1.1.1 (B:3-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mjuh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nfdf1 b.1.1.1 (F:1-114) Immunoglobulin heavy chain variable domain, VH {Hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1ct8b1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3c2ah1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 4 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rzfh1 b.1.1.1 (H:2-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yedb1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1b2wh1 b.1.1.1 (H:1-117) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} | Back information, alignment and structure |
|---|
| >d2p49b1 b.1.1.1 (B:1-121) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} | Back information, alignment and structure |
|---|
| >d2b1hh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} | Back information, alignment and structure |
|---|
| >d1n0xh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ad9b1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} | Back information, alignment and structure |
|---|
| >d1ieha_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]} | Back information, alignment and structure |
|---|
| >d1lo4h1 b.1.1.1 (H:1-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.1 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nkra2 b.1.1.4 (A:102-200) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3d85d1 b.1.1.4 (D:1-87) The p40 domain of interleukin-12 (IL-12 beta chain), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d3b5ha2 b.1.1.4 (A:23-102) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|