Diaphorina citri psyllid: psy2167


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------8
MMDERSPMAKYWMPLVWATNIINRARKEALISSDHVVQTLLYELSEHRRKLGSIISYDTVCVPLVYTQQNFLDAPTKHY
cccccccccccEEHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEEccccccc
*****SPMAKYWMPLVWATNIINRARKEALISSDHVVQTLLYELSEHRRKLGSIISYDTVCVPLVYTQQNFLDAPT***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMDERSPMAKYWMPLVWATNIINRARKEALISSDHVVQTLLYELSEHRRKLGSIISYDTVCVPLVYTQQNFLDAPTKHY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005777 [CC]peroxisomeprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0042579, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0006821 [BP]chloride transportprobableGO:0006811, GO:0006810, GO:0006820, GO:0044765, GO:0008150, GO:0015698, GO:0051234, GO:0051179, GO:0044699
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0072320 [MF]volume-sensitive chloride channel activityprobableGO:0022891, GO:0022838, GO:0022892, GO:0005215, GO:0005216, GO:0005225, GO:0015075, GO:0022857, GO:0008509, GO:0003674, GO:0015103, GO:0015267, GO:0022803, GO:0005253, GO:0005254, GO:0015108
GO:0006884 [BP]cell volume homeostasisprobableGO:0019725, GO:0009987, GO:0042592, GO:0065007, GO:0044763, GO:0008150, GO:0065008, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

No confident structure templates for the query are predicted