Psyllid ID: psy2167


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------8
MMDERSPMAKYWMPLVWATNIINRARKEALISSDHVVQTLLYELSEHRRKLGSIISYDTVCVPLVYTQQNFLDAPTKHY
cccccccccccEEHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEEccccccc
cccccccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcHHEcccEEEccEEEEEEEEEEcccccc
mmderspmakywmPLVWATNIINRARKEALISSDHVVQTLLYELSEHRRKLGSIISYDTVCVPLVytqqnfldaptkhy
MMDERSPMAKYWMPLVWATNIINRARKEALISSDHVVQTLLYELSEHRRKLGSIISYDTVCVPLVYTQqnfldaptkhy
MMDERSPMAKYWMPLVWATNIINRARKEALISSDHVVQTLLYELSEHRRKLGSIISYDTVCVPLVYTQQNFLDAPTKHY
********AKYWMPLVWATNIINRARKEALISSDHVVQTLLYELSEHRRKLGSIISYDTVCVPLVYTQQNFL*******
*****SPMAKYWMPLVWATNIINRARKEALISSDHVVQTLLYELSEHRRKLGSIISYDTVCVPLVYTQQNFLDAPT***
********AKYWMPLVWATNIINRARKEALISSDHVVQTLLYELSEHRRKLGSIISYDTVCVPLVYTQQNFLDAPTKHY
***ERSPMAKYWMPLVWATNIINRARKEALISSDHVVQTLLYELSEHRRKLGSIISYDTVCVPLVYTQQNFLDAPT***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMDERSPMAKYWMPLVWATNIINRARKEALISSDHVVQTLLYELSEHRRKLGSIISYDTVCVPLVYTQQNFLDAPTKHY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query79 2.2.26 [Sep-21-2011]
Q8NFU1 509 Bestrophin-2 OS=Homo sapi yes N/A 0.797 0.123 0.444 2e-09
Q8NFU0 473 Bestrophin-4 OS=Homo sapi no N/A 0.810 0.135 0.421 6e-09
Q8N1M1 668 Bestrophin-3 OS=Homo sapi no N/A 0.936 0.110 0.351 1e-08
Q6H1V1 669 Bestrophin-3 OS=Mus muscu yes N/A 0.936 0.110 0.351 1e-08
Q8BGM5 508 Bestrophin-2 OS=Mus muscu no N/A 0.797 0.124 0.412 1e-08
Q23369 499 Uncharacterized protein Z no N/A 0.860 0.136 0.323 1e-06
Q8WMR7 428 Bestrophin-1 (Fragment) O no N/A 0.784 0.144 0.387 3e-06
P34672 632 Uncharacterized protein Z no N/A 0.759 0.094 0.383 6e-06
O76090 585 Bestrophin-1 OS=Homo sapi no N/A 0.784 0.105 0.354 3e-05
Q6UY87 585 Bestrophin-1 OS=Macaca fa N/A N/A 0.784 0.105 0.354 3e-05
>sp|Q8NFU1|BEST2_HUMAN Bestrophin-2 OS=Homo sapiens GN=BEST2 PE=2 SV=1 Back     alignment and function desciption
 Score = 60.8 bits (146), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 28/63 (44%), Positives = 39/63 (61%)

Query: 6   SPMAKYWMPLVWATNIINRARKEALISSDHVVQTLLYELSEHRRKLGSIISYDTVCVPLV 65
           S   KYW+P VW +N+  +AR+E  I  +  ++ LL EL+  R K G +  YD + VPLV
Sbjct: 176 SSYNKYWVPCVWFSNLAAQARREGRIRDNSALKLLLEELNVFRGKCGMLFHYDWISVPLV 235

Query: 66  YTQ 68
           YTQ
Sbjct: 236 YTQ 238




Forms calcium-sensitive chloride channels. Permeable to bicarbonate.
Homo sapiens (taxid: 9606)
>sp|Q8NFU0|BEST4_HUMAN Bestrophin-4 OS=Homo sapiens GN=BEST4 PE=2 SV=1 Back     alignment and function description
>sp|Q8N1M1|BEST3_HUMAN Bestrophin-3 OS=Homo sapiens GN=BEST3 PE=2 SV=1 Back     alignment and function description
>sp|Q6H1V1|BEST3_MOUSE Bestrophin-3 OS=Mus musculus GN=Best3 PE=2 SV=1 Back     alignment and function description
>sp|Q8BGM5|BEST2_MOUSE Bestrophin-2 OS=Mus musculus GN=Best2 PE=2 SV=1 Back     alignment and function description
>sp|Q23369|YHDI_CAEEL Uncharacterized protein ZC518.1 OS=Caenorhabditis elegans GN=ZC518.1 PE=2 SV=1 Back     alignment and function description
>sp|Q8WMR7|BEST1_PIG Bestrophin-1 (Fragment) OS=Sus scrofa GN=BEST1 PE=1 SV=1 Back     alignment and function description
>sp|P34672|YO22_CAEEL Uncharacterized protein ZK688.2 OS=Caenorhabditis elegans GN=ZK688.2 PE=3 SV=1 Back     alignment and function description
>sp|O76090|BEST1_HUMAN Bestrophin-1 OS=Homo sapiens GN=BEST1 PE=1 SV=1 Back     alignment and function description
>sp|Q6UY87|BEST1_MACFA Bestrophin-1 OS=Macaca fascicularis GN=BEST1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query79
328708185 700 PREDICTED: bestrophin-3-like isoform 1 [ 0.860 0.097 0.882 5e-28
395398343 676 bestrophin 2 [Spodoptera littoralis] 0.848 0.099 0.805 5e-26
357631554 664 hypothetical protein KGM_15372 [Danaus p 0.848 0.100 0.805 6e-26
195377064 822 GJ11999 [Drosophila virilis] gi|19415447 0.848 0.081 0.776 7e-26
195015208 818 GH16281 [Drosophila grimshawi] gi|193897 0.848 0.081 0.776 9e-26
158292993 782 AGAP004881-PA [Anopheles gambiae str. PE 0.860 0.086 0.779 1e-25
345494944 894 PREDICTED: hypothetical protein LOC10011 0.860 0.076 0.779 2e-25
195126985 803 GI13224 [Drosophila mojavensis] gi|19391 0.848 0.083 0.761 2e-25
157131174 763 bestrophin 2,3,4 [Aedes aegypti] gi|1571 0.860 0.089 0.764 3e-25
33589428 809 RE18408p [Drosophila melanogaster] 0.848 0.082 0.746 5e-25
>gi|328708185|ref|XP_001944701.2| PREDICTED: bestrophin-3-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  128 bits (321), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 65/68 (95%)

Query: 1   MMDERSPMAKYWMPLVWATNIINRARKEALISSDHVVQTLLYELSEHRRKLGSIISYDTV 60
           MMDERSPM+KYWMPLVWATNIINRAR+E+LISSD VVQTLL ELS+ RR+LGSIISYDTV
Sbjct: 175 MMDERSPMSKYWMPLVWATNIINRARRESLISSDQVVQTLLVELSDIRRRLGSIISYDTV 234

Query: 61  CVPLVYTQ 68
           CVPLVYTQ
Sbjct: 235 CVPLVYTQ 242




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|395398343|gb|AFN57625.1| bestrophin 2 [Spodoptera littoralis] Back     alignment and taxonomy information
>gi|357631554|gb|EHJ79024.1| hypothetical protein KGM_15372 [Danaus plexippus] Back     alignment and taxonomy information
>gi|195377064|ref|XP_002047312.1| GJ11999 [Drosophila virilis] gi|194154470|gb|EDW69654.1| GJ11999 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195015208|ref|XP_001984157.1| GH16281 [Drosophila grimshawi] gi|193897639|gb|EDV96505.1| GH16281 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|158292993|ref|XP_558233.3| AGAP004881-PA [Anopheles gambiae str. PEST] gi|157016893|gb|EAL40404.3| AGAP004881-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|345494944|ref|XP_001603406.2| PREDICTED: hypothetical protein LOC100119673 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|195126985|ref|XP_002007949.1| GI13224 [Drosophila mojavensis] gi|193919558|gb|EDW18425.1| GI13224 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|157131174|ref|XP_001662152.1| bestrophin 2,3,4 [Aedes aegypti] gi|157133653|ref|XP_001656278.1| bestrophin 2,3,4 [Aedes aegypti] gi|108870740|gb|EAT34965.1| AAEL012831-PA [Aedes aegypti] gi|108871620|gb|EAT35845.1| AAEL012021-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|33589428|gb|AAQ22481.1| RE18408p [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query79
FB|FBgn0035696 809 Best2 "Bestrophin 2" [Drosophi 0.848 0.082 0.746 7.5e-24
FB|FBgn0040238 769 Best1 "Bestrophin 1" [Drosophi 0.848 0.087 0.514 4.7e-13
FB|FBgn0036492 535 Best3 "Bestrophin 3" [Drosophi 0.848 0.125 0.485 6.5e-12
FB|FBgn0036491 526 Best4 "Bestrophin 4" [Drosophi 0.848 0.127 0.470 1e-11
UNIPROTKB|F1SDY1 507 BEST2 "Uncharacterized protein 0.797 0.124 0.460 8.5e-10
UNIPROTKB|Q8NFU0 473 BEST4 "Bestrophin-4" [Homo sap 0.810 0.135 0.421 2.1e-09
UNIPROTKB|E2RSZ4 509 BEST2 "Uncharacterized protein 0.746 0.115 0.457 4.9e-09
UNIPROTKB|Q8NFU1 509 BEST2 "Bestrophin-2" [Homo sap 0.746 0.115 0.457 4.9e-09
UNIPROTKB|E1C882 669 BEST3 "Uncharacterized protein 0.835 0.098 0.424 5.8e-09
UNIPROTKB|E1C426 374 BEST4 "Uncharacterized protein 0.797 0.168 0.412 9.8e-09
FB|FBgn0035696 Best2 "Bestrophin 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 284 (105.0 bits), Expect = 7.5e-24, P = 7.5e-24
 Identities = 50/67 (74%), Positives = 62/67 (92%)

Query:     2 MDERSPMAKYWMPLVWATNIINRARKEALISSDHVVQTLLYELSEHRRKLGSIISYDTVC 61
             ++++SPM+KYWMPLVWATNIINRARK+ LI+SDH+VQT+L ELS+ RR+LG +I YDTVC
Sbjct:   180 LNQKSPMSKYWMPLVWATNIINRARKDGLIASDHIVQTILVELSDIRRRLGGLIGYDTVC 239

Query:    62 VPLVYTQ 68
             VPLVYTQ
Sbjct:   240 VPLVYTQ 246




GO:0016021 "integral to membrane" evidence=ISS
GO:0005253 "anion channel activity" evidence=ISS
GO:0006820 "anion transport" evidence=ISS
GO:0005777 "peroxisome" evidence=IDA
FB|FBgn0040238 Best1 "Bestrophin 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0036492 Best3 "Bestrophin 3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0036491 Best4 "Bestrophin 4" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1SDY1 BEST2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q8NFU0 BEST4 "Bestrophin-4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RSZ4 BEST2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q8NFU1 BEST2 "Bestrophin-2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1C882 BEST3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1C426 BEST4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query79
pfam01062284 pfam01062, Bestrophin, Bestrophin, RFP-TM, chlorid 1e-11
>gnl|CDD|216274 pfam01062, Bestrophin, Bestrophin, RFP-TM, chloride channel Back     alignment and domain information
 Score = 57.5 bits (140), Expect = 1e-11
 Identities = 23/65 (35%), Positives = 33/65 (50%), Gaps = 2/65 (3%)

Query: 4   ERSPMAKYWMPLVWATNIINRARKEALISSDHVVQTLLYELSEHRRKLGSIISYDTVCVP 63
            +S    Y + +VWA ++  +AR+E  I  D  +  L  EL+E R  LG     D   +P
Sbjct: 150 LQSSNPPYALLIVWAASL-AKARREGRID-DIQLVQLDEELNELRDALGGCERIDWTPIP 207

Query: 64  LVYTQ 68
           L YTQ
Sbjct: 208 LAYTQ 212


Bestrophin is a 68-kDa basolateral plasma membrane protein expressed in retinal pigment epithelial cells (RPE). It is encoded by the VMD2 gene, which is mutated in Best macular dystrophy, a disease characterized by a depressed light peak in the electrooculogram. VMD2 encodes a 585-amino acid protein with an approximate mass of 68 kDa which has been designated bestrophin. Bestrophin shares homology with the Caenorhabditis elegans RFP gene family, named for the presence of a conserved arginine (R), phenylalanine (F), proline (P), amino acid sequence motif. Bestrophin is a plasma membrane protein, localised to the basolateral surface of RPE cells consistent with a role for bestrophin in the generation or regulation of the EOG light peak. Bestrophin and other RFP family members represent a new class of chloride channels, indicating a direct role for bestrophin in generating the light peak. The VMD2 gene underlying Best disease was shown to represent the first human member of the RFP-TM protein family. More than 97% of the disease-causing mutations are located in the N-terminal RFP-TM domain implying important functional properties. The bestrophins are four-pass transmembrane chloride-channel proteins, and the RFP-TM or bestrophin domain extends from the N-terminus through approximately 350 amino acids and contains all of the TM domains as well as nearly all reported disease causing mutations. Interestingly, the RFP motif is not conserved evolutionarily back beyond Metazoa, neither is it in plant members. Length = 284

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 79
KOG3547|consensus 450 99.98
PF01062293 Bestrophin: Bestrophin, RFP-TM, chloride channel; 98.99
COG3781306 Predicted membrane protein [Function unknown] 82.21
>KOG3547|consensus Back     alignment and domain information
Probab=99.98  E-value=2.4e-33  Score=218.20  Aligned_cols=75  Identities=37%  Similarity=0.652  Sum_probs=71.5

Q ss_pred             CCCCC-CceeeHHHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHHHHHhcccccCcceecchhheeeeeEeeecccC
Q psy2167           5 RSPMA-KYWMPLVWATNIINRARKEALISSDHVVQTLLYELSEHRRKLGSIISYDTVCVPLVYTQQNFLDAPTKHY   79 (79)
Q Consensus         5 ~~~~~-kywvPi~Wa~~ll~~ar~eg~i~~~~~~~~l~~ei~~FR~~l~~L~~yDWVpIPLvY~QvV~lAV~~Yf~   79 (79)
                      ..+++ |||+||+|+.+|+++|+++|+|++|..++.+.+||++||++|++|++||||||||||||||+||||+||+
T Consensus       175 ~~~~~~kyw~Pi~Wa~sl~~~a~~~g~i~~d~~~~~~~~ei~~fR~~l~~L~~yDwVpIPL~YpQvV~lAVr~YF~  250 (450)
T KOG3547|consen  175 VDSKYMKYWVPINWAFSLLRKARKEGRIESDYLYNSLLGEIKKFRTGLSLLCNYDWVPIPLVYPQVVFLAVRSYFF  250 (450)
T ss_pred             ccccccceeecHHHHHHHHHHHHHcCCccccHHHHHHHHHHHHHHHhhccccCCCceeccccccceeeeehHHhHH
Confidence            34444 9999999999999999999999999999999999999999999999999999999999999999999995



>PF01062 Bestrophin: Bestrophin, RFP-TM, chloride channel; InterPro: IPR021134 Bestrophin is a 68kDa basolateral plasma membrane protein expressed in retinal pigment epithelial cells (RPE) Back     alignment and domain information
>COG3781 Predicted membrane protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

No hit with probability above 80.00