Diaphorina citri psyllid: psy2197


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390----
MTQTTRVYRLTSSDVQIEEVTVEGGLNNSSHNGNKVQSNMIKITNIEIALIQDDLKHNDTIIQIANSLDILDESMRNVFDHTKKSIWRTRQCLHAIEKRSSVVCANIEKLKNIQKSVTIVSKSKYPYPYNGNYSVHIQHEHVTPMYKCPLLLYDKTEINTRDIDNKLKFYHVKTNNMLHKNVELVCEESLGKLPAPIDSVMSSILFNTSDNVYEKYIIVHPGQVIARKPITKKHDHTEQVKMEDAPKSLISKGILRTDFSKLAVVLKLGAKTNKSIIWCQNSMARIKSTAGWNRTRSLALTRQTRYALPTKPTRPPVVSLGIQQLLAAEKRAAEKVAEAKKRKARRLKQAKEEAQEDIEKYRQEREKIFREYEAKVSHCNIVLIIKAAANYFMF
cccCEEEEEEcccccEEEEEEEEcccccccccccHHccccccccEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEECccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccHHHHHHccccccccccccccHHHccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccc
****TRV*RLTSSDVQIEEVTVE**************SNMIKITNIEIALIQDDLKHNDTIIQIANSLDILDESMRNVFDHTKKSIWRTRQCLHAIEKRSSVVCANIEKLKNIQKSVTIVSKSKYPYPYNGNYSVHIQHEHVTPMYKCPLLLYDKTEINTRDIDNKLKFYHVKTNNM*HKNVELV**********PIDSVMSSILFNTSDNVYEKYIIVHPGQVIARKPI******************LISKGILRTDFSKLAVVLKLGAKTNKSIIWCQNSMARIKSTAGWNRTRSLALTRQTRYALP*******VVSLGIQQL*****************************************KIFREYEAKVSHCNIVLIIKAAANYFMF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTQTTRVYRLTSSDVQIEEVTVEGGLNNSSHNGNKVQSNMIKITNIEIALIQDDLKHNDTIIQIANSLDILDESMRNVFDHTKKSIWRTRQCLHAIEKRSSVVCANIEKLKNIQKSVTIVSKSKYPYPYNGNYSVHIQHEHVTPMYKCPLLLYDKTEINTRDIDNKLKFYHVKTNNMLHKNVELVCEESLGKLPAPIDSVMSSILFNTSDNVYEKYIIVHPGQVIARKPITKKHDHTEQVKMEDAPKSLISKGILRTDFSKLAVVLKLGAKTNKSIIWCQNSMARIKSTAGWNRTRSLALTRQTRYALPTKPTRPPVVSLGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxYEAKVSHCNIVLIIKAAANYFMF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
V-type proton ATPase subunit G Catalytic subunit of the peripheral V1 complex of vacuolar ATPase (V-ATPase). V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.confidentQ9XZH6
Probable V-type proton ATPase subunit G Catalytic subunit of the peripheral V1 complex of vacuolar ATPase (V-ATPase). V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.confidentP91303

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4EFA, chain G
Confidence level:confident
Coverage over the Query: 317-390
View the alignment between query and template
View the model in PyMOL
Template: 3P8C, chain D
Confidence level:probable
Coverage over the Query: 60-113
View the alignment between query and template
View the model in PyMOL