Diaphorina citri psyllid: psy21


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------29
MGVVFETRIEEVQKKRKTELLCMNVSGAGSSSVAGTPSRGSVAPSKKRKLNILEEYESEERTSSGFQVTSSAKGNMEITEVDPDGKFVKLYNKGSEEQSLGNWQLVRKVQGEVKTSFKFHRTLKIEAGGTVTVWSFNVEGATHEPPHNIVMKNQKFGSGDEISTILLNTDGELANQERIIDNLRKEQSSLLLELKETKGRSGKYDTEMNELRAANYRLTERNKELEDQIEYEQSKFARMEAEIKRLQTEMTEQLKDYRELMEIKINLDVEIAQYRNLMEAEESSLPTY
ccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccEEEEEEcccccEEEEEEccccccccccEEEEEEEccccEEEEEcccccccccccEEEEEccccccccccccccHHHcccccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHccccccc
MGVVFETRIEEVQKKRKT*************************************************************EVDPDGKFVKLYNKGSEEQSLGNWQLVRKVQGEVKTSFKFHRTLKIEAGGTVTVWSFNVEGATHEPPHNIVMKNQKFGSGDEISTILLNTDGELANQERII***********************YDTEMNELRAANYR*T**********************EIKRLQTEMTEQLKDYRELMEIKINLDVEIAQYRNLMEAEESSL***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGVVFETRIEEVQKKRKTELLCMNVSGAGSSSVAGTPSRGSVAPSKKRKLNILEEYESEERTSSGFQVTSSAKGNMEITEVDPDGKFVKLYNKGSEEQSLGNWQLVRKVQGEVKTSFKFHRTLKIEAGGTVTVWSFNVEGATHEPPHNIVMKNQKFGSGDEISTIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSGKYDTExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKINLDVEIAQYRNLMEAEESSLPTY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005638 [CC]lamin filamentprobableGO:0031974, GO:0043229, GO:0043228, GO:0043227, GO:0043226, GO:0034399, GO:0005575, GO:0045111, GO:0031981, GO:0005634, GO:0044430, GO:0005652, GO:0005856, GO:0005882, GO:0043234, GO:0032991, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0005635 [CC]nuclear envelopeprobableGO:0005575, GO:0005623, GO:0005634, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1UFG, chain A
Confidence level:very confident
Coverage over the Query: 42-176
View the alignment between query and template
View the model in PyMOL
Template: 3TNU, chain A
Confidence level:very confident
Coverage over the Query: 200-280
View the alignment between query and template
View the model in PyMOL
Template: 1GK6, chain A
Confidence level:confident
Coverage over the Query: 1-21
View the alignment between query and template
View the model in PyMOL