Psyllid ID: psy21

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------29
MGVVFETRIEEVQKKRKTELLCMNVSGAGSSSVAGTPSRGSVAPSKKRKLNILEEYESEERTSSGFQVTSSAKGNMEITEVDPDGKFVKLYNKGSEEQSLGNWQLVRKVQGEVKTSFKFHRTLKIEAGGTVTVWSFNVEGATHEPPHNIVMKNQKFGSGDEISTILLNTDGELANQERIIDNLRKEQSSLLLELKETKGRSGKYDTEMNELRAANYRLTERNKELEDQIEYEQSKFARMEAEIKRLQTEMTEQLKDYRELMEIKINLDVEIAQYRNLMEAEESSLPTY
ccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccEEEEEEcccccEEEEEEccccccccccEEEEEEEccccEEEEEcccccccccccEEEEEcccccccccccccHHHHccccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHccccccc
cccHHHHHHHHHHHHHcccHHEEcccccccccccccccccccccccccEEEEEEEEEEcccEEEEEEEEEcccccEEEEEEcccccEEEEEEccccccccccEEEEEEEccccEEEEEccccEEEEcccEEEEEEcccccccccccccEEEEcccccccccEEEEEEcccccHHHEEEEHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHccccc
MGVVFETRIEEVQKKRKTELLCMnvsgagsssvagtpsrgsvapskkrKLNILEEyeseertssgfqvtssakgnmeitevdpdgkfvklynkgseeqslGNWQLVRKVQGEVKTSFKFHRTLKIEAGGTVTVWSFnvegathepphnivmknqkfgsgdeISTILLNTDGELANQERIIDNLRKEQSSLLLELKEtkgrsgkydtEMNELRAANYRLTERNKELEDQIEYEQSKFARMEAEIKRLQTEMTEQLKDYRELMEIKINLDVEIAQYRNLMEAeesslpty
MGVVFETRIEEVQKKRKTELLCMNVSgagsssvagtpsrgsvapskkrkLNILeeyeseertssgfqvtssakgnmeitevdpdGKFVKLYNKGseeqslgnwqlVRKVQGEVKTSFKFHRTLKIEAGGTVTVWSFNVEgathepphniVMKNQKFGSGDEISTILLNTDGELANQERIIDNLRKEQSSLLLelketkgrsgkydtemneLRAAnyrlternkeledQIEYEQSKFARMEAEIKRLQTEMTEQLKDYRELMEIKINLDVEIAQYRNLmeaeesslpty
MGVVFETRIEEVQKKRKTELLCMNvsgagsssvagTPSRGSVAPSKKRKLNILEEYESEERTSSGFQVTSSAKGNMEITEVDPDGKFVKLYNKGSEEQSLGNWQLVRKVQGEVKTSFKFHRTLKIEAGGTVTVWSFNVEGATHEPPHNIVMKNQKFGSGDEISTILLNTDGELANQERIIDNlrkeqsslllelketkGRSGKYDTEMNELRAANYRLTERNKELEDQIEYEQSKFARMEAEIKRLQTEMTEQLKDYRELMEIKINLDVEIAQYRNLMEAEESSLPTY
**************************************************************************************FVKLYN******SLGNWQLVRKVQGEVKTSFKFHRTLKIEAGGTVTVWSFNVEGATHEPPHNIVMKNQKFGSGDEISTILLNTDGELA****II*************************************************************************LKDYRELMEIKINLDVEIAQYRN************
MGVVFETRIEEVQKKRKT*************************************************************EVDPDGKFVKLYNKGSEEQSLGNWQLVRKVQGEVKTSFKFHRTLKIEAGGTV*****************IVMKNQKFGSGDEISTILLNTDGELANQERII***********************YDTEMNELRAANYR*T**********************EIKRLQTEMTEQLKDYRELMEIKINLDVEIAQYRNLMEAEESSL***
MGVVFETRIEEVQKKRKTELLCMNVSGA*******************RKLNILEEY************TSSAKGNMEITEVDPDGKFVKLYNKGSEEQSLGNWQLVRKVQGEVKTSFKFHRTLKIEAGGTVTVWSFNVEGATHEPPHNIVMKNQKFGSGDEISTILLNTDGELANQERIIDNLRKEQSSLLLELKETKGRSGKYDTEMNELRAANYRLTERNKELEDQIEYEQSKFARMEAEIKRLQTEMTEQLKDYRELMEIKINLDVEIAQYRNLME*********
*GVVFETRIEEVQKKRKTELLCM************************RKLNILEEYESEERTSSGFQVTSSAKGNMEITEVDPDGKFVKLYNKGSEEQSLGNWQLVRKVQGEVKTSFKFHRTLKIEAGGTVTVWSFNVEGATHEPPHNIVMKNQKFGSGDEISTILLNTDGELANQERIIDNLRKEQSSLLLELKETKGRSGKYDTEMNELRAANYRLTERNKELEDQIEYEQSKFARMEAEIKRLQTEMTEQLKDYRELMEIKINLDVEIAQYRNLMEAEESSL*TY
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGVVFETRIEEVQKKRKTELLCMNVSGAGSSSVAGTPSRGSVAPSKKRKLNILEEYESEERTSSGFQVTSSAKGNMEITEVDPDGKFVKLYNKGSEEQSLGNWQLVRKVQGEVKTSFKFHRTLKIEAGGTVTVWSFNVEGATHEPPHNIVMKNQKFGSGDEISTIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSGKYDTExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKINLDVEIAQYRNLMEAEESSLPTY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query288 2.2.26 [Sep-21-2011]
P08928622 Lamin Dm0 OS=Drosophila m yes N/A 0.506 0.234 0.483 9e-36
Q03427621 Lamin-C OS=Drosophila mel no N/A 0.524 0.243 0.403 1e-25
P11048665 Lamin-A OS=Xenopus laevis N/A N/A 0.434 0.187 0.436 9e-23
P02545664 Prelamin-A/C OS=Homo sapi no N/A 0.472 0.204 0.401 2e-20
P21619596 Lamin-B2 OS=Mus musculus yes N/A 0.413 0.199 0.380 2e-19
Q3ZD69664 Prelamin-A/C OS=Sus scrof yes N/A 0.461 0.200 0.393 2e-19
P13648657 Lamin-A OS=Gallus gallus yes N/A 0.375 0.164 0.390 3e-19
P14733588 Lamin-B1 OS=Mus musculus no N/A 0.336 0.164 0.41 7e-19
P20700586 Lamin-B1 OS=Homo sapiens no N/A 0.336 0.165 0.4 1e-18
P14732600 Lamin-B2 OS=Gallus gallus yes N/A 0.368 0.176 0.418 1e-18
>sp|P08928|LAM0_DROME Lamin Dm0 OS=Drosophila melanogaster GN=Lam PE=1 SV=4 Back     alignment and function desciption
 Score =  150 bits (380), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 112/151 (74%), Gaps = 5/151 (3%)

Query: 31  SSVAGTPSRGSVAPSKKRKLNILEEYESEERTSSGFQVTSSAKGNMEITEVDPDGKFVKL 90
           +S   TPSR + + + KRK  +++E  SE+ + + + V++SAKGN+EI E+DP+GKFV+L
Sbjct: 430 NSTRATPSRRTPSAAVKRKRAVVDE--SEDHSVADYYVSASAKGNVEIKEIDPEGKFVRL 487

Query: 91  YNKGSEEQSLGNWQLVRKVQGE-VKTSFKFHRTLKIEAGGTVTVWSFNVEGATHEPPHNI 149
           +NKGSEE ++G WQL R +  +   T++KFHR+++IE  G +TVWS + + A+HEPP ++
Sbjct: 488 FNKGSEEVAIGGWQLQRLINEKGPSTTYKFHRSVRIEPNGVITVWSADTK-ASHEPPSSL 546

Query: 150 VMKNQKFGSGDEISTILLNTDGE-LANQERI 179
           VMK+QK+ S D   TILLN++GE +AN +RI
Sbjct: 547 VMKSQKWVSADNTRTILLNSEGEAVANLDRI 577
Lamins are components of the nuclear lamina, a fibrous layer on the nucleoplasmic side of the inner nuclear membrane, which is thought to provide a framework for the nuclear envelope and may also interact with chromatin.
Drosophila melanogaster (taxid: 7227)
>sp|Q03427|LAMC_DROME Lamin-C OS=Drosophila melanogaster GN=LamC PE=1 SV=2 Back     alignment and function description
>sp|P11048|LMNA_XENLA Lamin-A OS=Xenopus laevis GN=lmna PE=2 SV=1 Back     alignment and function description
>sp|P02545|LMNA_HUMAN Prelamin-A/C OS=Homo sapiens GN=LMNA PE=1 SV=1 Back     alignment and function description
>sp|P21619|LMNB2_MOUSE Lamin-B2 OS=Mus musculus GN=Lmnb2 PE=1 SV=2 Back     alignment and function description
>sp|Q3ZD69|LMNA_PIG Prelamin-A/C OS=Sus scrofa GN=LMNA PE=3 SV=1 Back     alignment and function description
>sp|P13648|LMNA_CHICK Lamin-A OS=Gallus gallus GN=LMNA PE=2 SV=1 Back     alignment and function description
>sp|P14733|LMNB1_MOUSE Lamin-B1 OS=Mus musculus GN=Lmnb1 PE=1 SV=3 Back     alignment and function description
>sp|P20700|LMNB1_HUMAN Lamin-B1 OS=Homo sapiens GN=LMNB1 PE=1 SV=2 Back     alignment and function description
>sp|P14732|LMNB2_CHICK Lamin-B2 OS=Gallus gallus GN=LMNB2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query288
328785544 597 PREDICTED: lamin Dm0-like [Apis mellifer 0.506 0.244 0.525 1e-37
194759125 624 GF15147 [Drosophila ananassae] gi|190615 0.506 0.233 0.523 2e-37
195034692 625 GH10295 [Drosophila grimshawi] gi|193904 0.534 0.246 0.508 2e-37
195388484 623 GJ19583 [Drosophila virilis] gi|19414936 0.534 0.247 0.508 2e-37
340722208 599 PREDICTED: lamin Dm0-like [Bombus terres 0.583 0.280 0.482 3e-37
383850116 599 PREDICTED: lamin Dm0-like [Megachile rot 0.461 0.222 0.562 1e-36
350396311 599 PREDICTED: lamin Dm0-like [Bombus impati 0.583 0.280 0.477 1e-36
156544736 603 PREDICTED: lamin Dm0-like isoform 1 [Nas 0.597 0.285 0.472 3e-36
345480744 600 PREDICTED: lamin Dm0-like isoform 2 [Nas 0.597 0.286 0.472 3e-36
60099934 499 lamin [Drosophila miranda] gi|60099936|g 0.506 0.292 0.523 8e-36
>gi|328785544|ref|XP_396670.3| PREDICTED: lamin Dm0-like [Apis mellifera] gi|380029157|ref|XP_003698248.1| PREDICTED: lamin Dm0-like [Apis florea] Back     alignment and taxonomy information
 Score =  162 bits (411), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 81/154 (52%), Positives = 110/154 (71%), Gaps = 8/154 (5%)

Query: 23  MNVSGAGSSSVAG----TPSRGSVAPSKKRKLNILEEYESEERTSSGFQVTSSAKGNMEI 78
           +N++   SSS A     TPSR +     KRK  +LEE  SEERTS+ + V+ +++G++EI
Sbjct: 401 LNINPVQSSSTASSGRTTPSRHTPLRGGKRKRTLLEE--SEERTSTDYSVSGTSRGDIEI 458

Query: 79  TEVDPDGKFVKLYNKGSEEQSLGNWQLVRKVQGEVKTSFKFHRTLKIEAGGTVTVWSFNV 138
           TE DP G+FVKL NKG++E  L  WQ++RK  G ++T FKFHRT K+EAG TV VWS ++
Sbjct: 459 TEADPQGRFVKLTNKGNKEMGLSGWQIIRKA-GSLETVFKFHRTAKLEAGATVMVWSADI 517

Query: 139 EGATHEPPHNIVMKNQKFGSGDEISTILLNTDGE 172
            GA+HEPP NIVMK QK+ + D ++TILLN +GE
Sbjct: 518 -GASHEPPSNIVMKGQKWFTADIMTTILLNNEGE 550

Source: Apis mellifera

Species: Apis mellifera

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|194759125|ref|XP_001961800.1| GF15147 [Drosophila ananassae] gi|190615497|gb|EDV31021.1| GF15147 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|195034692|ref|XP_001988956.1| GH10295 [Drosophila grimshawi] gi|193904956|gb|EDW03823.1| GH10295 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|195388484|ref|XP_002052910.1| GJ19583 [Drosophila virilis] gi|194149367|gb|EDW65065.1| GJ19583 [Drosophila virilis] Back     alignment and taxonomy information
>gi|340722208|ref|XP_003399500.1| PREDICTED: lamin Dm0-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|383850116|ref|XP_003700663.1| PREDICTED: lamin Dm0-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|350396311|ref|XP_003484509.1| PREDICTED: lamin Dm0-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|156544736|ref|XP_001605883.1| PREDICTED: lamin Dm0-like isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|345480744|ref|XP_003424206.1| PREDICTED: lamin Dm0-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|60099934|gb|AAX13101.1| lamin [Drosophila miranda] gi|60099936|gb|AAX13102.1| lamin [Drosophila miranda] gi|60099938|gb|AAX13103.1| lamin [Drosophila miranda] gi|60099940|gb|AAX13104.1| lamin [Drosophila miranda] gi|60099942|gb|AAX13105.1| lamin [Drosophila miranda] gi|60099944|gb|AAX13106.1| lamin [Drosophila miranda] gi|60099946|gb|AAX13107.1| lamin [Drosophila miranda] gi|60099948|gb|AAX13108.1| lamin [Drosophila miranda] gi|60099950|gb|AAX13109.1| lamin [Drosophila miranda] gi|60099952|gb|AAX13110.1| lamin [Drosophila miranda] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query288
FB|FBgn0002525622 Lam "Lamin" [Drosophila melano 0.489 0.226 0.493 5.9e-33
FB|FBgn0010397621 LamC "Lamin C" [Drosophila mel 0.486 0.225 0.416 4.2e-24
UNIPROTKB|P14731584 LMNB1 "Lamin-B1" [Gallus gallu 0.486 0.239 0.347 1.5e-22
UNIPROTKB|F1PBK4454 LMNB1 "Uncharacterized protein 0.486 0.308 0.354 6.3e-21
UNIPROTKB|J9P3G1475 LMNB1 "Uncharacterized protein 0.486 0.294 0.354 7.5e-21
UNIPROTKB|F1NAM2584 LMNB1 "Lamin-B1" [Gallus gallu 0.486 0.239 0.347 1.1e-20
UNIPROTKB|F1NR20585 LMNB1 "Lamin-B1" [Gallus gallu 0.486 0.239 0.347 1.1e-20
MGI|MGI:96795588 Lmnb1 "lamin B1" [Mus musculus 0.486 0.238 0.361 1.1e-20
UNIPROTKB|F1PBJ3665 LMNA "Uncharacterized protein" 0.472 0.204 0.383 1.1e-20
UNIPROTKB|P20700586 LMNB1 "Lamin-B1" [Homo sapiens 0.486 0.238 0.354 1.4e-20
FB|FBgn0002525 Lam "Lamin" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 365 (133.5 bits), Expect = 5.9e-33, P = 5.9e-33
 Identities = 72/146 (49%), Positives = 110/146 (75%)

Query:    36 TPSRGSVAPSKKRKLNILEEYESEERTSSGFQVTSSAKGNMEITEVDPDGKFVKLYNKGS 95
             TPSR + + + KRK  +++E  SE+ + + + V++SAKGN+EI E+DP+GKFV+L+NKGS
Sbjct:   435 TPSRRTPSAAVKRKRAVVDE--SEDHSVADYYVSASAKGNVEIKEIDPEGKFVRLFNKGS 492

Query:    96 EEQSLGNWQLVRKVQGE-VKTSFKFHRTLKIEAGGTVTVWSFNVEGATHEPPHNIVMKNQ 154
             EE ++G WQL R +  +   T++KFHR+++IE  G +TVWS + + A+HEPP ++VMK+Q
Sbjct:   493 EEVAIGGWQLQRLINEKGPSTTYKFHRSVRIEPNGVITVWSADTK-ASHEPPSSLVMKSQ 551

Query:   155 KFGSGDEISTILLNTDGE-LANQERI 179
             K+ S D   TILLN++GE +AN +RI
Sbjct:   552 KWVSADNTRTILLNSEGEAVANLDRI 577
GO:0005638 "lamin filament" evidence=IDA;TAS
GO:0007084 "mitotic nuclear envelope reassembly" evidence=IDA
GO:0007430 "terminal branching, open tracheal system" evidence=IMP
GO:0005652 "nuclear lamina" evidence=IDA
GO:0031081 "nuclear pore distribution" evidence=IMP
GO:0006998 "nuclear envelope organization" evidence=IMP
GO:0005198 "structural molecule activity" evidence=IMP
GO:0005515 "protein binding" evidence=IPI
GO:0005634 "nucleus" evidence=IDA
GO:0007097 "nuclear migration" evidence=IMP
GO:0090435 "protein localization to nuclear envelope" evidence=IMP
GO:0005635 "nuclear envelope" evidence=IDA
GO:0071763 "nuclear membrane organization" evidence=IDA
GO:0035262 "gonad morphogenesis" evidence=IMP
GO:0048546 "digestive tract morphogenesis" evidence=IMP
GO:0001745 "compound eye morphogenesis" evidence=IMP
GO:0007417 "central nervous system development" evidence=IMP
GO:0040003 "chitin-based cuticle development" evidence=IMP
GO:0005811 "lipid particle" evidence=IDA
GO:0005875 "microtubule associated complex" evidence=IDA
GO:0006342 "chromatin silencing" evidence=IDA;IMP
GO:0051297 "centrosome organization" evidence=IMP
GO:0072686 "mitotic spindle" evidence=IDA
GO:0005813 "centrosome" evidence=IDA
GO:0046331 "lateral inhibition" evidence=IMP
GO:0007569 "cell aging" evidence=IMP
GO:0008344 "adult locomotory behavior" evidence=IMP
FB|FBgn0010397 LamC "Lamin C" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|P14731 LMNB1 "Lamin-B1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1PBK4 LMNB1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9P3G1 LMNB1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1NAM2 LMNB1 "Lamin-B1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NR20 LMNB1 "Lamin-B1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:96795 Lmnb1 "lamin B1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1PBJ3 LMNA "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P20700 LMNB1 "Lamin-B1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query288
pfam00932108 pfam00932, LTD, Lamin Tail Domain 9e-14
pfam00038312 pfam00038, Filament, Intermediate filament protein 9e-11
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 3e-05
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-04
PRK03992 389 PRK03992, PRK03992, proteasome-activating nucleoti 4e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.001
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.001
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.002
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.003
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.004
>gnl|CDD|216203 pfam00932, LTD, Lamin Tail Domain Back     alignment and domain information 
 Score = 66.0 bits (161), Expect = 9e-14
 Identities = 32/115 (27%), Positives = 52/115 (45%), Gaps = 15/115 (13%)

Query: 68  VTSSAKGNMEITEVDPDG---KFVKLYNKGSEEQSLGNWQLVRKVQGEVKTSFKFHRTLK 124
              SA GN+ I+E D  G   ++++LYN  +    L  W L          ++ F   + 
Sbjct: 1   APVSAAGNVIISEYDEGGSNNEWIELYNTSAAAVDLSGWTLKDS-----GNTYTFPPGVV 55

Query: 125 IEAGGTVTVWSFNVEGATHEPPHNIVMKNQ---KFGSGDEISTILLNTDGELANQ 176
           +E G TVTV++    GA   P  + V        +G+G +    LL+ DGE+ + 
Sbjct: 56  LEPGATVTVYA---GGAGDNPTFDAVWGLSTQPIWGNGGDT-VTLLDADGEVVDS 106

The lamin-tail domain (LTD), which has an immunoglobulin (Ig) fold, is found in Nuclear Lamins, Chlo1887 from Chloroflexus, and several bacterial proteins where it occurs with membrane associated hydrolases of the metallo-beta-lactamase,synaptojanin, and calcineurin-like phosphoesterase superfamilies. Length = 108
>gnl|CDD|200948 pfam00038, Filament, Intermediate filament protein Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 288
KOG0977|consensus546 100.0
PF00038312 Filament: Intermediate filament protein; InterPro: 99.75
PF00932116 LTD: Lamin Tail Domain; InterPro: IPR001322 Interm 99.56
KOG0977|consensus 546 99.53
PF00038312 Filament: Intermediate filament protein; InterPro: 96.72
KOG4642|consensus284 95.51
PRK11637 428 AmiB activator; Provisional 94.94
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 94.86
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 94.43
PRK11637 428 AmiB activator; Provisional 94.21
PRK09039 343 hypothetical protein; Validated 93.99
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 93.88
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 93.18
PRK10884206 SH3 domain-containing protein; Provisional 93.02
PRK09039 343 hypothetical protein; Validated 92.68
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 92.56
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 92.21
PF10146 230 zf-C4H2: Zinc finger-containing protein ; InterPro 92.09
PF10146 230 zf-C4H2: Zinc finger-containing protein ; InterPro 91.64
PF14662193 CCDC155: Coiled-coil region of CCDC155 91.36
KOG0161|consensus 1930 91.13
PRK15178434 Vi polysaccharide export inner membrane protein Ve 90.98
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 90.82
PF11932 251 DUF3450: Protein of unknown function (DUF3450); In 90.53
COG4942 420 Membrane-bound metallopeptidase [Cell division and 89.86
PF10234267 Cluap1: Clusterin-associated protein-1; InterPro: 89.78
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 89.53
COG3883 265 Uncharacterized protein conserved in bacteria [Fun 89.36
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 88.95
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 88.92
TIGR02338110 gimC_beta prefoldin, beta subunit, archaeal. Chape 88.7
COG4026290 Uncharacterized protein containing TOPRIM domain, 88.53
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 88.46
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 88.41
PF10186 302 Atg14: UV radiation resistance protein and autopha 88.26
PRK0211973 hypothetical protein; Provisional 88.23
PF00345122 PapD_N: Pili and flagellar-assembly chaperone, Pap 88.19
PF03148384 Tektin: Tektin family; InterPro: IPR000435 Tektin 88.0
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 87.58
PF09726 697 Macoilin: Transmembrane protein; InterPro: IPR0191 87.46
PF13851201 GAS: Growth-arrest specific micro-tubule binding 87.19
COG3883 265 Uncharacterized protein conserved in bacteria [Fun 86.73
KOG4687|consensus 389 86.61
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 86.22
COG307479 Uncharacterized protein conserved in bacteria [Fun 86.04
COG2433 652 Uncharacterized conserved protein [Function unknow 85.88
PF09726 697 Macoilin: Transmembrane protein; InterPro: IPR0191 85.72
PF09304107 Cortex-I_coil: Cortexillin I, coiled coil; InterPr 85.61
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 85.47
PF04871136 Uso1_p115_C: Uso1 / p115 like vesicle tethering pr 85.4
PRK0440675 hypothetical protein; Provisional 85.01
PF0882661 DMPK_coil: DMPK coiled coil domain like; InterPro: 84.79
COG2433 652 Uncharacterized conserved protein [Function unknow 84.79
KOG4603|consensus201 84.22
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 84.12
KOG0250|consensus 1074 83.73
PF0858179 Tup_N: Tup N-terminal; InterPro: IPR013890 The N-t 83.64
PF0864796 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395 83.47
PF1232974 TMF_DNA_bd: TATA element modulatory factor 1 DNA b 83.32
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 83.26
KOG1962|consensus216 83.24
PRK02224 880 chromosome segregation protein; Provisional 83.13
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 83.09
KOG4807|consensus593 82.91
PRK02224 880 chromosome segregation protein; Provisional 82.8
PF0410269 SlyX: SlyX; InterPro: IPR007236 The SlyX protein h 82.52
PRK0029568 hypothetical protein; Provisional 82.47
PF04111 314 APG6: Autophagy protein Apg6; InterPro: IPR007243 82.28
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 82.2
PRK0073668 hypothetical protein; Provisional 82.12
PRK0279372 phi X174 lysis protein; Provisional 82.12
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 81.92
PF04111 314 APG6: Autophagy protein Apg6; InterPro: IPR007243 81.86
PF02050123 FliJ: Flagellar FliJ protein; InterPro: IPR012823 81.21
KOG0976|consensus 1265 81.18
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 81.07
PF14282106 FlxA: FlxA-like protein 80.77
PRK09343121 prefoldin subunit beta; Provisional 80.69
KOG2264|consensus 907 80.68
PRK0432574 hypothetical protein; Provisional 80.57
PF06818202 Fez1: Fez1; InterPro: IPR009638 This family repres 80.56
PF14662193 CCDC155: Coiled-coil region of CCDC155 80.25
KOG0250|consensus 1074 80.16
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 80.14
PRK0440675 hypothetical protein; Provisional 80.01
>KOG0977|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.1e-36  Score=298.88  Aligned_cols=166  Identities=36%  Similarity=0.638  Sum_probs=138.2

Q ss_pred             ccchhhhhHHHHhhhhhhhhcccccCCCCCCccC---CCCCCC-cCCcccchhhhhhcccccccccceeEEeeCCCCCeE
Q psy21             2 GVVFETRIEEVQKKRKTELLCMNVSGAGSSSVAG---TPSRGS-VAPSKKRKLNILEEYESEERTSSGFQVTSSAKGNME   77 (288)
Q Consensus         2 ~~~ld~ei~~yrklle~ee~r~~~~~~~~~~~~~---~~~~~~-~~~~~kr~r~~~~~~~s~~~~~~~~~~~~sa~G~v~   77 (288)
                      |++||+||++|||||||||.|   +|++.+.+..   +++... +++.+.|.  ..+      .+..+.+++++|+|+|.
T Consensus       372 ki~Ld~EI~~YRkLLegee~r---~~~~~s~~~~~~s~~s~~~~~~~~~~r~--~~g------e~~~~ss~~r~a~g~v~  440 (546)
T KOG0977|consen  372 KISLDAEIAAYRKLLEGEEER---TGSLSSLVVQNVSTSSPRAVRDTRSSRT--VIG------ESESRSSYSRSAKGNVA  440 (546)
T ss_pred             HhHHHhHHHHHHHHhccccCC---CCccceeEEeecccCCCcccccCCCccc--ccC------ccccccccccccCCCcc
Confidence            689999999999999999999   4545444431   111111 12222222  111      12233489999999999


Q ss_pred             EEeecCCCcEEEEEeCCccceeccCeEEEEEeCCcccEEEEecCCeEecCCcEEEEEecccCCCCCCCCCceeeecc-cc
Q psy21            78 ITEVDPDGKFVKLYNKGSEEQSLGNWQLVRKVQGEVKTSFKFHRTLKIEAGGTVTVWSFNVEGATHEPPHNIVMKNQ-KF  156 (288)
Q Consensus        78 I~e~d~~GkfV~l~N~s~~~~~L~gw~l~r~v~~~~~~~y~Fp~~~~L~~g~~vtIwa~~~~~~~~~pp~dlv~~~~-~w  156 (288)
                      |.||||+||||++.|++.+++++|||+|+|.+||...++|+||++++|+||++|||||+++ |+.|+||+++||+.+ +|
T Consensus       441 i~e~d~~gk~i~~~n~~~~~~~~g~~kl~r~~~~~~~i~~~f~~~~~~~~g~~v~i~~a~~-G~~~~Pp~~lV~~~~~~w  519 (546)
T KOG0977|consen  441 IHECDPEGKFIRLNNKSSEEESIGGWKLRRKIDGKREIVFKFPSGYVLKPGASVTIWAADA-GAVHNPPESLVMKGENTW  519 (546)
T ss_pred             eeecccccceeeeccccccccCCCcceEEEecCCcceEEEECCCCceecCCceEEEeecCC-CCccCCCcceeecCCccc
Confidence            9999999999999999999999999999999998788999999999999999999999999 999999999999998 99


Q ss_pred             cCccchhhheeccchh-HHHHHHH
Q psy21           157 GSGDEISTILLNTDGE-LANQERI  179 (288)
Q Consensus       157 g~g~~i~t~L~d~~ge-vA~~~~~  179 (288)
                      |.|+++.|.|+|.+|+ +|.+.+.
T Consensus       520 g~g~~~~t~l~n~~ge~~as~~~~  543 (546)
T KOG0977|consen  520 GIGASVRTILYNSEGEEVASHSQV  543 (546)
T ss_pred             ccCCCcceeeccccceeeeeeeee
Confidence            9999999999999999 9988653

>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PF00932 LTD: Lamin Tail Domain; InterPro: IPR001322 Intermediate filaments (IF) are primordial components of the cytoskeleton and the nuclear envelope [] Back     alignment and domain information
>KOG0977|consensus Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>KOG4642|consensus Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>KOG0161|consensus Back     alignment and domain information
>PRK15178 Vi polysaccharide export inner membrane protein VexD; Provisional Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>TIGR02338 gimC_beta prefoldin, beta subunit, archaeal Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>PRK02119 hypothetical protein; Provisional Back     alignment and domain information
>PF00345 PapD_N: Pili and flagellar-assembly chaperone, PapD N-terminal domain; InterPro: IPR016147 Most Gram-negative bacteria possess a supramolecular structure - the pili - on their surface, which mediates attachment to specific receptors Back     alignment and domain information
>PF03148 Tektin: Tektin family; InterPro: IPR000435 Tektin heteropolymers form unique protofilaments of flagellar microtubules [] Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4687|consensus Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>PF04871 Uso1_p115_C: Uso1 / p115 like vesicle tethering protein, C terminal region; InterPro: IPR006955 This domain identifies a group of proteins, which are described as: General vesicular transport factor, Transcytosis associate protein (TAP) and Vesicle docking protein Back     alignment and domain information
>PRK04406 hypothetical protein; Provisional Back     alignment and domain information
>PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4603|consensus Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0250|consensus Back     alignment and domain information
>PF08581 Tup_N: Tup N-terminal; InterPro: IPR013890 The N-terminal region of the Tup protein has been shown to interact with the Ssn6 transcriptional co-repressor [] Back     alignment and domain information
>PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions [] Back     alignment and domain information
>PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG1962|consensus Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>KOG4807|consensus Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function Back     alignment and domain information
>PRK00295 hypothetical protein; Provisional Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK00736 hypothetical protein; Provisional Back     alignment and domain information
>PRK02793 phi X174 lysis protein; Provisional Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF02050 FliJ: Flagellar FliJ protein; InterPro: IPR012823 Many flagellar proteins are exported by a flagellum-specific export pathway Back     alignment and domain information
>KOG0976|consensus Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>PF14282 FlxA: FlxA-like protein Back     alignment and domain information
>PRK09343 prefoldin subunit beta; Provisional Back     alignment and domain information
>KOG2264|consensus Back     alignment and domain information
>PRK04325 hypothetical protein; Provisional Back     alignment and domain information
>PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>KOG0250|consensus Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PRK04406 hypothetical protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query288
3umn_A123 Crystal Structure Of Lamin-B1 Length = 123 2e-18
2kpw_A122 Nmr Solution Structure Of Lamin-B1 Protein From Hom 5e-18
1ivt_A122 Nmr Structures Of The C-Terminal Globular Domain Of 2e-17
1ifr_A121 Structure Of Lamin AC GLOBULAR DOMAIN Length = 121 2e-17
1ufg_A151 Solution Structure Of Immunoglobulin Like Domain Of 3e-17
2lll_A139 Solution Nmr Structure Of C-Terminal Globular Domai 4e-17
3gef_A118 Crystal Structure Of The R482w Mutant Of Lamin AC L 4e-17
3jt0_A144 Crystal Structure Of The C-Terminal Fragment (426-5 5e-17
1gk4_A84 Human Vimentin Coil 2b Fragment (Cys2) Length = 84 1e-07
3tyy_A95 Crystal Structure Of Human Lamin-B1 Coil 2 Segment 2e-06
1x8y_A86 Human Lamin Coil 2b Length = 86 2e-05
3v4w_A74 Structure Of E347k Mutant Of Lamin Length = 74 4e-05
3tnu_B129 Heterocomplex Of Coil 2b Domains Of Human Intermedi 6e-05
3v5b_A74 Structure Of Coil 2b Of Human Lamin Length = 74 7e-05
3v4q_A74 Structure Of R335w Mutant Of Human Lamin Length = 7 7e-05
1gk6_A59 Human Vimentin Coil 2b Fragment Linked To Gcn4 Leuc 1e-04
>pdb|3UMN|A Chain A, Crystal Structure Of Lamin-B1 Length = 123 Back     alignment and structure 
Iteration: 1

 Score = 89.7 bits (221), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 70/110 (63%), Gaps = 3/110 (2%)
Query: 72  AKGNMEITEVDPDGKFVKLYNKGSEEQSLGNWQLVRKVQGEVKTSFKFHRTLKIEAGGTV 131
           A GN+ I E+D DGKF++L N   ++Q +G W+++RK+ G+   S+K+     ++AG TV
Sbjct: 11  ATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKI-GDTSVSYKYTSRYVLKAGQTV 69
Query: 132 TVWSFNVEGATHEPPHNIVMKNQ-KFGSGDEISTILLNTDGELANQERII 180
           T+W+ N  G T  PP +++ KNQ  +G+G+++  IL N+ GE   Q   +
Sbjct: 70  TIWAANA-GVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRSTV 118
>pdb|2KPW|A Chain A, Nmr Solution Structure Of Lamin-B1 Protein From Homo Sapiens: Northeast Structural Genomics Consortium Mega Target, Hr5546a (439-549) Length = 122 Back     alignment and structure
>pdb|1IVT|A Chain A, Nmr Structures Of The C-Terminal Globular Domain Of Human Lamin AC Length = 122 Back     alignment and structure
>pdb|1IFR|A Chain A, Structure Of Lamin AC GLOBULAR DOMAIN Length = 121 Back     alignment and structure
>pdb|1UFG|A Chain A, Solution Structure Of Immunoglobulin Like Domain Of Mouse Nuclear Lamin Length = 151 Back     alignment and structure
>pdb|2LLL|A Chain A, Solution Nmr Structure Of C-Terminal Globular Domain Of Human Lamin- B2, Northeast Structural Genomics Consortium Target Hr8546a Length = 139 Back     alignment and structure
>pdb|3GEF|A Chain A, Crystal Structure Of The R482w Mutant Of Lamin AC Length = 118 Back     alignment and structure
>pdb|3JT0|A Chain A, Crystal Structure Of The C-Terminal Fragment (426-558) Lamin-B1 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr5546a Length = 144 Back     alignment and structure
>pdb|1GK4|A Chain A, Human Vimentin Coil 2b Fragment (Cys2) Length = 84 Back     alignment and structure
>pdb|3TYY|A Chain A, Crystal Structure Of Human Lamin-B1 Coil 2 Segment Length = 95 Back     alignment and structure
>pdb|1X8Y|A Chain A, Human Lamin Coil 2b Length = 86 Back     alignment and structure
>pdb|3V4W|A Chain A, Structure Of E347k Mutant Of Lamin Length = 74 Back     alignment and structure
>pdb|3TNU|B Chain B, Heterocomplex Of Coil 2b Domains Of Human Intermediate Filament Proteins, Keratin 5 (Krt5) And Keratin 14 (Krt14) Length = 129 Back     alignment and structure
>pdb|3V5B|A Chain A, Structure Of Coil 2b Of Human Lamin Length = 74 Back     alignment and structure
>pdb|3V4Q|A Chain A, Structure Of R335w Mutant Of Human Lamin Length = 74 Back     alignment and structure
>pdb|1GK6|A Chain A, Human Vimentin Coil 2b Fragment Linked To Gcn4 Leucine Zipper (Z2b) Length = 59 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query288
2lll_A139 Lamin-B2; immunoglobulin-like fold, structural pro 1e-38
1ufg_A151 Lamin A, nuclear lamin; immunoglobulin like fold, 3e-38
3hn9_A123 Lamin-B1; structural genomics, structural genomics 3e-37
1ifr_A121 Lamin A/C; immunoglobulin, immune system; 1.40A {H 6e-36
3jt0_A144 Lamin-B1; structural genomics, PSI-2, protein stru 3e-34
1x8y_A86 Lamin A/C; structural protein, intermediate filame 1e-16
1gk4_A84 Vimentin; intermediate filament, dimer, parallel c 1e-15
2xv5_A74 Lamin-A/C; structural protein, intermediate filame 5e-15
3mov_A95 Lamin-B1; LMNB1, B-type lamins, intermediate filam 6e-15
1gk6_A59 Vimentin; intermediate filament, dimer, parallel c 1e-14
3tnu_B129 Keratin, type II cytoskeletal 5; coiled-coil, stru 3e-12
3tnu_A131 Keratin, type I cytoskeletal 14; coiled-coil, stru 9e-12
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 1e-06
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 7e-06
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 1e-05
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 1e-05
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 4e-05
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 2e-04
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 1e-04
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
>2lll_A Lamin-B2; immunoglobulin-like fold, structural protein, NESG, northeas structural genomics consortium, SGC; NMR {Homo sapiens} Length = 139 Back     alignment and structure
 Score =  132 bits (332), Expect = 1e-38
 Identities = 45/139 (32%), Positives = 74/139 (53%), Gaps = 3/139 (2%)

Query: 53  LEEYESEERTSSGFQVTSSAKGNMEITEVDPDGKFVKLYNKGSEEQSLGNWQLVRKVQGE 112
           +  +              SA G++ I E+D +GKFV+L N   ++QSLGNW++ R+V   
Sbjct: 1   MHHHHHHSSGRENLYFQGSASGSVSIEEIDLEGKFVQLKNNSDKDQSLGNWRIKRQVLEG 60

Query: 113 VKTSFKFHRTLKIEAGGTVTVWSFNVEGATHEPPHNIVMKNQ-KFGSGDEISTILLNTDG 171
            + ++KF     + AG  VTVW+    G  H PP  +V K Q  +G+G+   T+L+N DG
Sbjct: 61  EEIAYKFTPKYILRAGQMVTVWAAG-AGVAHSPPSTLVWKGQSSWGTGESFRTVLVNADG 119

Query: 172 E-LANQERIIDNLRKEQSS 189
           E +A +     ++ +E  +
Sbjct: 120 EEVAMRTVKKSSVMRENEN 138
>1ufg_A Lamin A, nuclear lamin; immunoglobulin like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Mus musculus} SCOP: b.1.16.1 Length = 151 Back     alignment and structure
>1ifr_A Lamin A/C; immunoglobulin, immune system; 1.40A {Homo sapiens} SCOP: b.1.16.1 PDB: 1ivt_A 3gef_A Length = 121 Back     alignment and structure
>3jt0_A Lamin-B1; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG, HR5546A, LMNB1_human; 2.39A {Homo sapiens} Length = 144 Back     alignment and structure
>1x8y_A Lamin A/C; structural protein, intermediate filament protein; 2.20A {Homo sapiens} SCOP: h.1.20.1 PDB: 3v5b_A 3v4w_A 3v4q_A Length = 86 Back     alignment and structure
>1gk4_A Vimentin; intermediate filament, dimer, parallel coiled coil, heptad repeat, stutter; 2.3A {Homo sapiens} SCOP: h.1.20.1 Length = 84 Back     alignment and structure
>2xv5_A Lamin-A/C; structural protein, intermediate filaments, nuclear membrane LEFT-handed coiled coil, right-handed coiled coil; HET: MSE; 2.40A {Homo sapiens} Length = 74 Back     alignment and structure
>1gk6_A Vimentin; intermediate filament, dimer, parallel coiled coil, heptad repeat, leucine zipper, fusion protein; 1.9A {Saccharomyces cerevisiae} SCOP: h.1.20.1 Length = 59 Back     alignment and structure
>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Length = 129 Back     alignment and structure
>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Length = 131 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query288
1ufg_A151 Lamin A, nuclear lamin; immunoglobulin like fold, 100.0
3hn9_A123 Lamin-B1; structural genomics, structural genomics 100.0
3jt0_A144 Lamin-B1; structural genomics, PSI-2, protein stru 100.0
2lll_A139 Lamin-B2; immunoglobulin-like fold, structural pro 100.0
1ifr_A121 Lamin A/C; immunoglobulin, immune system; 1.40A {H 100.0
3tnu_A131 Keratin, type I cytoskeletal 14; coiled-coil, stru 99.89
3tnu_B129 Keratin, type II cytoskeletal 5; coiled-coil, stru 99.89
1gk4_A84 Vimentin; intermediate filament, dimer, parallel c 99.87
1x8y_A86 Lamin A/C; structural protein, intermediate filame 99.85
3mov_A95 Lamin-B1; LMNB1, B-type lamins, intermediate filam 99.83
1gk6_A59 Vimentin; intermediate filament, dimer, parallel c 99.79
2xv5_A74 Lamin-A/C; structural protein, intermediate filame 99.77
2xv5_A74 Lamin-A/C; structural protein, intermediate filame 98.98
1gk6_A59 Vimentin; intermediate filament, dimer, parallel c 98.63
3trt_A77 Vimentin; cytoskeleton, intermediate filament, alp 97.73
3tnu_B129 Keratin, type II cytoskeletal 5; coiled-coil, stru 95.66
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coi 95.45
3tnu_A131 Keratin, type I cytoskeletal 14; coiled-coil, stru 95.28
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 94.32
3cvf_A79 Homer-3, homer protein homolog 3; coiled coil, alt 93.42
3cve_A72 Homer protein homolog 1; coiled coil, alternative 92.97
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 92.46
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 90.75
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 89.77
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 89.69
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 89.58
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 89.28
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 88.66
3swk_A86 Vimentin; cytoskeleton, intermediate filament, alp 88.57
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 88.24
3swk_A86 Vimentin; cytoskeleton, intermediate filament, alp 87.86
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 87.77
3u59_A101 Tropomyosin beta chain; muscle contraction, actin, 87.72
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 86.65
3mq7_A121 Bone marrow stromal antigen 2; HIV, antiviral prot 86.63
1x8y_A86 Lamin A/C; structural protein, intermediate filame 86.17
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coi 85.89
2lw1_A89 ABC transporter ATP-binding protein UUP; ABC REG s 85.34
1l8d_A112 DNA double-strand break repair RAD50 ATPase; zinc 85.17
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 84.61
3qh9_A81 Liprin-beta-2; coiled-coil, dimerization, structur 84.09
2zqm_A117 Prefoldin beta subunit 1; chaperone; HET: CIT; 1.9 84.0
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 83.84
1gk4_A84 Vimentin; intermediate filament, dimer, parallel c 83.65
3cvf_A79 Homer-3, homer protein homolog 3; coiled coil, alt 83.65
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 83.21
1ic2_A81 Tropomyosin alpha chain, skeletal muscle; alpha-he 82.46
2wt7_B90 Transcription factor MAFB; transcription, transcri 82.1
3viq_B85 Mating-type switching protein SWI5; recombination 81.69
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 81.4
>1ufg_A Lamin A, nuclear lamin; immunoglobulin like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Mus musculus} SCOP: b.1.16.1 Back     alignment and structure
Probab=100.00  E-value=1.2e-40  Score=279.86  Aligned_cols=128  Identities=36%  Similarity=0.668  Sum_probs=116.4

Q ss_pred             cCCcccchhhhhhcccccccccceeEEeeCCCCCeEEEeecCCCcEEEEEeCCccceeccCeEEEEEeCCcccEEEEecC
Q psy21            42 VAPSKKRKLNILEEYESEERTSSGFQVTSSAKGNMEITEVDPDGKFVKLYNKGSEEQSLGNWQLVRKVQGEVKTSFKFHR  121 (288)
Q Consensus        42 ~~~~~kr~r~~~~~~~s~~~~~~~~~~~~sa~G~v~I~e~d~~GkfV~l~N~s~~~~~L~gw~l~r~v~~~~~~~y~Fp~  121 (288)
                      +++++||||++.++      ...+++.+++|+|+|+|.|||++|+||+|+|+++++++|+||+|+|.+++..+++|+||+
T Consensus        12 ~~~~~kr~r~~~~~------~~~~~~~sa~a~G~V~I~E~d~~GefV~L~N~s~~~~~L~GW~L~r~vdg~~~~~y~Fp~   85 (151)
T 1ufg_A           12 GGSVTKKRKLESSE------SRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIRRQNGDDPLMTYRFPP   85 (151)
T ss_dssp             CCCCCSSSSCCCCC------CCCCSCCEEEECSSEEEEEECTTSSEEEEEECSSSCEECSSCEEEEEETTSCCEEEECCT
T ss_pred             cccccceeeecccc------cceeEEEecccCCCEEEEEECCCCCEEEEEECCCCccccCCCEEEEecCCCccEEEEECC
Confidence            46778999987643      224566777778999999999999999999999999999999999999987789999999


Q ss_pred             CeEecCCcEEEEEecccCCCCCCCCCceeeecc-cccCccchhhheeccchh-HHHH
Q psy21           122 TLKIEAGGTVTVWSFNVEGATHEPPHNIVMKNQ-KFGSGDEISTILLNTDGE-LANQ  176 (288)
Q Consensus       122 ~~~L~~g~~vtIwa~~~~~~~~~pp~dlv~~~~-~wg~g~~i~t~L~d~~ge-vA~~  176 (288)
                      +|+|+||++||||++++ ++.|+||+||+|+++ +|++|++|.|+|+|++|| +|++
T Consensus        86 ~~~L~pg~tVtIws~~~-g~~~~pp~dlv~k~q~sWg~G~~~~T~L~n~~GEevA~~  141 (151)
T 1ufg_A           86 KFTLKAGQVVTIWASGA-GATHSPPTDLVWKAQNTWGCGSSLRTALINSTGEEVAMR  141 (151)
T ss_dssp             TCEECTTCEEEEEESSS-SCCCCTTTEEEECSSSCSCCSSEEEEEEECSSSCEEEEE
T ss_pred             CcEECCCCEEEEEeCCC-CCCCCCchhEEEecccccCCCCCEEEEEECCCCCEEEEE
Confidence            99999999999999998 889999999999999 899999999999999999 9984
>3jt0_A Lamin-B1; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG, HR5546A, LMNB1_human; 2.39A {Homo sapiens} Back     alignment and structure
>2lll_A Lamin-B2; immunoglobulin-like fold, structural protein, NESG, northeas structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>1ifr_A Lamin A/C; immunoglobulin, immune system; 1.40A {Homo sapiens} SCOP: b.1.16.1 PDB: 1ivt_A 3gef_A Back     alignment and structure
>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>1gk4_A Vimentin; intermediate filament, dimer, parallel coiled coil, heptad repeat, stutter; 2.3A {Homo sapiens} SCOP: h.1.20.1 Back     alignment and structure
>1x8y_A Lamin A/C; structural protein, intermediate filament protein; 2.20A {Homo sapiens} SCOP: h.1.20.1 PDB: 3v5b_A 3v4w_A 3v4q_A Back     alignment and structure
>1gk6_A Vimentin; intermediate filament, dimer, parallel coiled coil, heptad repeat, leucine zipper, fusion protein; 1.9A {Saccharomyces cerevisiae} SCOP: h.1.20.1 Back     alignment and structure
>2xv5_A Lamin-A/C; structural protein, intermediate filaments, nuclear membrane LEFT-handed coiled coil, right-handed coiled coil; HET: MSE; 2.40A {Homo sapiens} Back     alignment and structure
>2xv5_A Lamin-A/C; structural protein, intermediate filaments, nuclear membrane LEFT-handed coiled coil, right-handed coiled coil; HET: MSE; 2.40A {Homo sapiens} Back     alignment and structure
>1gk6_A Vimentin; intermediate filament, dimer, parallel coiled coil, heptad repeat, leucine zipper, fusion protein; 1.9A {Saccharomyces cerevisiae} SCOP: h.1.20.1 Back     alignment and structure
>3trt_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural protein; 2.30A {Homo sapiens} PDB: 3klt_A* Back     alignment and structure
>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure
>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} Back     alignment and structure
>3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus} Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} Back     alignment and structure
>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A Back     alignment and structure
>1x8y_A Lamin A/C; structural protein, intermediate filament protein; 2.20A {Homo sapiens} SCOP: h.1.20.1 PDB: 3v5b_A 3v4w_A 3v4q_A Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>2lw1_A ABC transporter ATP-binding protein UUP; ABC REG subfamily, DNA binding protein; NMR {Escherichia coli} Back     alignment and structure
>1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>3qh9_A Liprin-beta-2; coiled-coil, dimerization, structural protein; 2.01A {Homo sapiens} Back     alignment and structure
>2zqm_A Prefoldin beta subunit 1; chaperone; HET: CIT; 1.90A {Thermococcus SP} PDB: 2zdi_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1gk4_A Vimentin; intermediate filament, dimer, parallel coiled coil, heptad repeat, stutter; 2.3A {Homo sapiens} SCOP: h.1.20.1 Back     alignment and structure
>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Back     alignment and structure
>3viq_B Mating-type switching protein SWI5; recombination activator; 2.20A {Schizosaccharomyces pombe} PDB: 3vir_A* Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 288
d1ifra_113 b.1.16.1 (A:) Lamin A/C globular tail domain {Huma 5e-33
>d1ifra_ b.1.16.1 (A:) Lamin A/C globular tail domain {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure

class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Lamin A/C globular tail domain
family: Lamin A/C globular tail domain
domain: Lamin A/C globular tail domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  114 bits (288), Expect = 5e-33
 Identities = 41/105 (39%), Positives = 66/105 (62%), Gaps = 2/105 (1%)

Query: 69  TSSAKGNMEITEVDPDGKFVKLYNKGSEEQSLGNWQLVRKVQGEVKTSFKFHRTLKIEAG 128
           +    G + + EVD +GKFV+L NK +E+QS+GNWQ+ R+   +   +++F     ++AG
Sbjct: 2   SHRTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFPPKFTLKAG 61

Query: 129 GTVTVWSFNVEGATHEPPHNIVMKNQK-FGSGDEISTILLNTDGE 172
             VT+W+    GATH PP ++V K Q  +G G+ + T L+N+ GE
Sbjct: 62  QVVTIWAAGA-GATHSPPTDLVWKAQNTWGCGNSLRTALINSTGE 105

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query288
d1ifra_113 Lamin A/C globular tail domain {Human (Homo sapien 99.96
d1fxka_107 Prefoldin beta subunit {Archaeon Methanobacterium 88.41
>d1ifra_ b.1.16.1 (A:) Lamin A/C globular tail domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Lamin A/C globular tail domain
family: Lamin A/C globular tail domain
domain: Lamin A/C globular tail domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.96  E-value=7e-31  Score=209.48  Aligned_cols=107  Identities=39%  Similarity=0.777  Sum_probs=101.1

Q ss_pred             eCCCCCeEEEeecCCCcEEEEEeCCccceeccCeEEEEEeCCcccEEEEecCCeEecCCcEEEEEecccCCCCCCCCCce
Q psy21            70 SSAKGNMEITEVDPDGKFVKLYNKGSEEQSLGNWQLVRKVQGEVKTSFKFHRTLKIEAGGTVTVWSFNVEGATHEPPHNI  149 (288)
Q Consensus        70 ~sa~G~v~I~e~d~~GkfV~l~N~s~~~~~L~gw~l~r~v~~~~~~~y~Fp~~~~L~~g~~vtIwa~~~~~~~~~pp~dl  149 (288)
                      +.++|+|.|.|||++|+||.|+|+++++++|+||+|++.+++....+|+||++++|+||++|+||+.++ +..|+||.++
T Consensus         3 ~~s~G~v~I~E~d~~ge~VeL~N~~~~~vdL~Gw~l~d~~~~~~~~~f~fP~~~~l~pg~~v~i~~~~~-~~~~~~~~~~   81 (113)
T d1ifra_           3 HRTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFPPKFTLKAGQVVTIWAAGA-GATHSPPTDL   81 (113)
T ss_dssp             EEECSSEEEEEECTTSSEEEEEECSSSCEECTTCEEEEEETTSCCEEEECCSSCEECTTCEEEEEETTS-SCCCBTTTEE
T ss_pred             ccCCCCEEEEEECCCCCEEEEEeCCCCcCccCCCEEEeccCCCcceEEEeCCCCEECCCCEEEEEECCC-CCCCCCcccE
Confidence            345699999999999999999999999999999999999998888999999999999999999999998 7889999999


Q ss_pred             eeecc-cccCccchhhheeccchh-HHHHH
Q psy21           150 VMKNQ-KFGSGDEISTILLNTDGE-LANQE  177 (288)
Q Consensus       150 v~~~~-~wg~g~~i~t~L~d~~ge-vA~~~  177 (288)
                      +|+++ .|++|+++.|.|+|++|+ +|+|+
T Consensus        82 ~~~~~~~wg~g~~~~t~L~n~~Ge~vAt~~  111 (113)
T d1ifra_          82 VWKAQNTWGCGNSLRTALINSTGEEVAMRK  111 (113)
T ss_dssp             EETTCSCCCCSSCEEEEEECTTSCEEEEEE
T ss_pred             EEeccccccCCCCcEEEEECCCCCEEEEEE
Confidence            99998 999999999999999999 99863
>d1fxka_ a.2.5.1 (A:) Prefoldin beta subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure