Diaphorina citri psyllid: psy2206


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430
MAPKPYGPKENRLRKRPICLPSAQHTGTQEVSRMVKFGYPDLYEKFVLFYSRYVYRRIVDCFNRPVTSVPGAIITIKDRETPDYGWTFKYTGTESTCLNLASYNYLGFGENTGLCTERSKESVKQSGCALCSPSGEIASMLSKGASKSNILFQAHTNGFANGISKSNGLLSSNGGYPDLYEKFVLFYSRYVYRRIVDCFNRPVTSVPGAIITIKDRETPDYGWTFKYTGTESTCLNLASYNYLGFGENTGLCTERSKESVKQSGCALCSPSAPSSLEAGLQKALLEGQPHSGKPWRKILIVVEGIFSMDGSIVRLPEIVRLKNKYKAYLYVDEAHSIGALGPTGRGVTEYFGIDPREVDILMGTYTKSFGSMGGYVAGSKSTIDYIRANSHVRSYATSMPPPVAMQILTSMRIIMGLENGDEGNVRHSSI
ccccccccHHHcccccccccccccccccHHHHccccccccccccccHHHHHHHHccccccccccccccccccEEEEEEccccccccCEECcccccEEEEEcccccccccccccccHHHHHHHHHHccccccccccHHcccHHHHHHHHHHHHHHHHccccccEEEccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccEEEcccccccccccccccccccHHHHHccccccccccccccccccccccHHHHcccccccccccccHHHHHHHHHHccccccccccccEEEEEEccccccccccccHHHHHHHHHccEEEEEEcccccccccccccccccccccccccEEEEEcccccccccccccccccHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHccccccHHHHHHHcc
*APKPYGPKENRLRKRPICLPSAQHT***EVSRMVKFGYPDLYEKFVLFYSRYVYRRIVDCFNRPVTSVPGAIITIKDRETPDYGWTFKYTGTESTCLNLASYNYLGFGENTGLCTERSKESVKQSGCALCSPSGEIASMLSKGASKSNILFQAHTNGFANGISKSNGLLSSNGGYPDLYEKFVLFYSRYVYRRIVDCFNRPVTSVPGAIITIKDRETPDYGWTFKYTGTESTCLNLASYNYLGFGENTGLCTERSKESVKQSGCALCSPSAPSSLEAGLQKALLEG****GKPWRKILIVVEGIFSMDGSIVRLPEIVRLKNKYKAYLYVDEAHSIGALGPTGRGVTEYFGIDPREVDILMGTYTKSFGSMGGYVAGSKSTIDYIRANSHVRSYATSMPPPVAMQILTSMRIIMGL*******VR****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAPKPYGPKENRLRKRPICLPSAQHTGTQEVSRMVKFGYPDLYEKFVLFYSRYVYRRIVDCFNRPVTSVPGAIITIKDRETPDYGWTFKYTGTESTCLNLASYNYLGFGENTGLCTERSKESVKQSGCALCSPSGEIASMLSKGASKSNILFQAHTNGFANGISKSNGLLSSNGGYPDLYEKFVLFYSRYVYRRIVDCFNRPVTSVPGAIITIKDRETPDYGWTFKYTGTESTCLNLASYNYLGFGENTGLCTERSKESVKQSGCALCSPSAPSSLEAGLQKALLEGQPHSGKPWRKILIVVEGIFSMDGSIVRLPEIVRLKNKYKAYLYVDEAHSIGALGPTGRGVTEYFGIDPREVDILMGTYTKSFGSMGGYVAGSKSTIDYIRANSHVRSYATSMPPPVAMQILTSMRIIMGLENGDEGNVRHSSI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine palmitoyltransferase 2 Catalytic subunit of serine palmitoyltransferase (SPT), which catalyzes the committed step in the synthesis of sphingolipids, the condensation of serine with palmitoyl CoA to form the long chain base 3-ketosphinganine.confidentQ54EX5
Serine palmitoyltransferase 3 Component of the serine palmitoyltransferase (SPT) that catalyzes the first committed step in sphingolipid biosynthesis, which is the condensation of an acyl-CoA species and L-serine. The catalytic core is composed of a heterodimer of sptl-1 and sptl-2 or sptl-1 and sptl-3 (By similarity). Required for the specification of abicobasal polarity and development of the gut lumen.confidentQ9XVI6

Prediction of Gene Ontology Terms ?

No confident GO terms associated with the query are predicted

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2BWN, chain A
Confidence level:very confident
Coverage over the Query: 179-416
View the alignment between query and template
View the model in PyMOL
Template: 3A2B, chain A
Confidence level:confident
Coverage over the Query: 62-78,95-138
View the alignment between query and template
View the model in PyMOL