Diaphorina citri psyllid: psy222

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-----

MSDEQKSAKNSPSSHHSEVRDSKSSSQTVEPRDAKSSSGQTVKYWYPYCITYDPIQAGSIDGTDTIPHDRAILRALRSTYKPHTSSTDPTRTLFIGRLNKNSREADLEQAFAEYGKVISVRVVRDFVTGHSKRYGFLEYDCEKACLAAIRALNRQNFQGSEIIVDFECGRVLPGWKPRRLGGGWGGNRNSGQLRFGGRNKPWVKPVQLMNERELGEWRKQGGAGS

ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccEEEEcccccccHHHHHHHHHHccccEEEEEEEcccccccccEEEEEEccHHHHHHHHHHHccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccHHHccHHcccccccc

****************************************TVKYWYPYCITYDPIQAGSIDGTDTIPHDRAILRALRST********DPTRTLFIGRLNKNSREADLEQAFAEYGKVISVRVVRDFVTGHSKRYGFLEYDCEKACLAAIRALNRQNFQGSEIIVDFECGRVLPGWKP************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
U11/U12 small nuclear ribonucleoprotein 35 kDa protein		confident	Q5U1W5
U11/U12 small nuclear ribonucleoprotein 35 kDa protein		confident	Q1LZH0
U11/U12 small nuclear ribonucleoprotein 35 kDa protein		confident	Q16560

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005689 [CC]	U12-type spliceosomal complex	probable	GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0006417 [BP]	regulation of translation	probable	GO:0032268, GO:0009889, GO:0080090, GO:0019222, GO:0051246, GO:0060255, GO:0010608, GO:0031323, GO:2000112, GO:0050794, GO:0050789, GO:0010556, GO:0065007, GO:0031326, GO:0008150, GO:0010468
GO:0010033 [BP]	response to organic substance	probable	GO:0042221, GO:0050896, GO:0008150
GO:0043232 [CC]	intracellular non-membrane-bounded organelle	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0009507 [CC]	chloroplast	probable	GO:0005737, GO:0009536, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0006950 [BP]	response to stress	probable	GO:0050896, GO:0008150
GO:0003690 [MF]	double-stranded DNA binding	probable	GO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0003697 [MF]	single-stranded DNA binding	probable	GO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0009987 [BP]	cellular process	probable	GO:0008150
GO:0009628 [BP]	response to abiotic stimulus	probable	GO:0050896, GO:0008150
GO:0003729 [MF]	mRNA binding	probable	GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1FXL, chain A
Confidence level:very confident
Coverage over the Query: 90-171
View the alignment between query and template
View the model in PyMOL

Template: 2G4B, chain A
Confidence level:very confident
Coverage over the Query: 44-167
View the alignment between query and template
View the model in PyMOL