Psyllid ID: psy222


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-----
MSDEQKSAKNSPSSHHSEVRDSKSSSQTVEPRDAKSSSGQTVKYWYPYCITYDPIQAGSIDGTDTIPHDRAILRALRSTYKPHTSSTDPTRTLFIGRLNKNSREADLEQAFAEYGKVISVRVVRDFVTGHSKRYGFLEYDCEKACLAAIRALNRQNFQGSEIIVDFECGRVLPGWKPRRLGGGWGGNRNSGQLRFGGRNKPWVKPVQLMNERELGEWRKQGGAGS
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccEEEEcccccccHHHHHHHHHHccccEEEEEEEcccccccccEEEEEEccHHHHHHHHHHHccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccHHHccHHcccccccc
ccccccccccccccccEEEccccccccccccccccccccccccccccHHccccccEccccccccccccccHHHHHHHHccccccccccccEEEEEEEccccccHHHHHHHHHHcccEEEEEEEEEccccccccEEEEEEccHHHHHHHHHHHcccEEcccEEEEEcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccc
msdeqksaknspsshhsevrdsksssqtveprdaksssgqtvkywypycitydpiqagsidgtdtiphDRAILRALRstykphtsstdptrtLFIGRLNKNSREADLEQAFAEYGKVISVRVVRDFvtghskrygfleYDCEKACLAAIRALNRqnfqgseiivdfecgrvlpgwkprrlgggwggnrnsgqlrfggrnkpwvkpvqLMNERELGEWRKQGGAGS
msdeqksaknspsshhsevrdsksssqtveprdaksssgqtvkYWYPYCITYDPIQAGSIDGTDTIPHDRAILRALrstykphtsstdptrtlfIGRLNKNSREADLEQAFAEYGKVISVRVVRDFVTGHSKRYGFLEYDCEKACLAAIRALNRQNFQGSEIIVDFECGRVLPGwkprrlgggwggnrnsgqlrfggrnkpwvkpvqlmnerelgewrkqggags
MSDEQKSAKNSPSSHHSEVRDSKSSSQTVEPRDAKSSSGQTVKYWYPYCITYDPIQAGSIDGTDTIPHDRAILRALRSTYKPHTSSTDPTRTLFIGRLNKNSREADLEQAFAEYGKVISVRVVRDFVTGHSKRYGFLEYDCEKACLAAIRALNRQNFQGSEIIVDFECGRVlpgwkprrlgggwggNRNSGQLRFGGRNKPWVKPVQLMNERELGEWRKQGGAGS
****************************************TVKYWYPYCITYDPIQAGSIDGTDTIPHDRAILRALRST************TLFIGRLN*****ADLEQAFAEYGKVISVRVVRDFVTGHSKRYGFLEYDCEKACLAAIRALNRQNFQGSEIIVDFECGRVLPGWKPRRLGGGWGGNRNSGQLRFGGRNKPWVKPV*******************
***********************************************YCITY***********************************DPTRTLFIGRLNKNSREADLEQAFAEYGKVISVRVVRDFVTGHSKRYGFLEYDCEKACLAAIRALNRQNFQGSEIIVDFECGRVL*****************************************************
***************************************QTVKYWYPYCITYDPIQAGSIDGTDTIPHDRAILRALRSTYKPHTSSTDPTRTLFIGRLNKNSREADLEQAFAEYGKVISVRVVRDFVTGHSKRYGFLEYDCEKACLAAIRALNRQNFQGSEIIVDFECGRVLPGWKPRRLGGGWGGNRNSGQLRFGGRNKPWVKPVQLMNERELGE*********
****************************************TVKYWYPYCITYDPIQAGSIDGTDTIPHDRAILRALRSTYKPHTSSTDPTRTLFIGRLNKNSREADLEQAFAEYGKVISVRVVRDFVTGHSKRYGFLEYDCEKACLAAIRALNRQNFQGSEIIVDFECGRVLPGWKP************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDEQKSAKNSPSSHHSEVRDSKSSSQTVEPRDAKSSSGQTVKYWYPYCITYDPIQAGSIDGTDTIPHDRAILRALRSTYKPHTSSTDPTRTLFIGRLNKNSREADLEQAFAEYGKVISVRVVRDFVTGHSKRYGFLEYDCEKACLAAIRALNRQNFQGSEIIVDFECGRVLPGWKPRRLGGGWGGNRNSGQLRFGGRNKPWVKPVQLMNERELGEWRKQGGAGS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query225 2.2.26 [Sep-21-2011]
Q05AT9272 U11/U12 small nuclear rib N/A N/A 0.728 0.602 0.515 7e-39
Q4KMD3208 U11/U12 small nuclear rib yes N/A 0.746 0.807 0.491 2e-38
Q5U1W5244 U11/U12 small nuclear rib yes N/A 0.728 0.672 0.515 5e-37
Q1LZH0245 U11/U12 small nuclear rib yes N/A 0.728 0.669 0.509 5e-37
Q9D384244 U11/U12 small nuclear rib yes N/A 0.728 0.672 0.509 1e-36
Q16560246 U11/U12 small nuclear rib yes N/A 0.728 0.666 0.503 3e-36
Q42404 427 U1 small nuclear ribonucl no N/A 0.524 0.276 0.381 2e-18
O13829261 U1 small nuclear ribonucl yes N/A 0.408 0.352 0.391 3e-14
Q55FQ0 459 U1 small nuclear ribonucl yes N/A 0.551 0.270 0.307 7e-13
P17133 448 U1 small nuclear ribonucl yes N/A 0.422 0.212 0.336 3e-11
>sp|Q05AT9|U1SBP_XENLA U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Xenopus laevis GN=snrnp35 PE=2 SV=1 Back     alignment and function desciption
 Score =  160 bits (405), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 85/165 (51%), Positives = 110/165 (66%), Gaps = 1/165 (0%)

Query: 45  WYPYCITYDPIQAGSIDGTDTIPHDRAILRALRSTYKPHTSST-DPTRTLFIGRLNKNSR 103
           W P    YDP++AGSIDGTD  PHDRA+LRA+ S Y P+   T DP  TLF+ RL+  + 
Sbjct: 4   WTPIAKKYDPLKAGSIDGTDEEPHDRAVLRAMLSRYVPNKGVTGDPHLTLFVSRLSPQTT 63

Query: 104 EADLEQAFAEYGKVISVRVVRDFVTGHSKRYGFLEYDCEKACLAAIRALNRQNFQGSEII 163
           E  L++ F+ YG +  +R+VRDF+TG SK Y F+EY  E A + A R  N+      E+ 
Sbjct: 64  EEKLKEVFSRYGDIKRIRLVRDFITGFSKGYAFIEYKQENAIMKAHRDANKLVIDQREVF 123

Query: 164 VDFECGRVLPGWKPRRLGGGWGGNRNSGQLRFGGRNKPWVKPVQL 208
           VDFE  R L GW PRR GGG+GG + SGQLRFGGR++P+ KP+ L
Sbjct: 124 VDFELERNLKGWIPRRFGGGFGGKKESGQLRFGGRDRPFRKPINL 168





Xenopus laevis (taxid: 8355)
>sp|Q4KMD3|U1SBP_DANRE U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Danio rerio GN=snrnp35 PE=2 SV=1 Back     alignment and function description
>sp|Q5U1W5|U1SBP_RAT U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Rattus norvegicus GN=Snrnp35 PE=2 SV=1 Back     alignment and function description
>sp|Q1LZH0|U1SBP_BOVIN U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Bos taurus GN=SNRNP35 PE=2 SV=1 Back     alignment and function description
>sp|Q9D384|U1SBP_MOUSE U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Mus musculus GN=Snrnp35 PE=2 SV=1 Back     alignment and function description
>sp|Q16560|U1SBP_HUMAN U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Homo sapiens GN=SNRNP35 PE=1 SV=1 Back     alignment and function description
>sp|Q42404|RU17_ARATH U1 small nuclear ribonucleoprotein 70 kDa OS=Arabidopsis thaliana GN=RNU1 PE=1 SV=1 Back     alignment and function description
>sp|O13829|RU17_SCHPO U1 small nuclear ribonucleoprotein 70 kDa homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=usp101 PE=1 SV=1 Back     alignment and function description
>sp|Q55FQ0|RU17_DICDI U1 small nuclear ribonucleoprotein 70 kDa OS=Dictyostelium discoideum GN=snrnp70 PE=3 SV=1 Back     alignment and function description
>sp|P17133|RU17_DROME U1 small nuclear ribonucleoprotein 70 kDa OS=Drosophila melanogaster GN=snRNP-U1-70K PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query225
193631809300 PREDICTED: u11/U12 small nuclear ribonuc 0.742 0.556 0.529 3e-46
321460332240 hypothetical protein DAPPUDRAFT_308886 [ 0.737 0.691 0.532 9e-46
449279308254 U11/U12 small nuclear ribonucleoprotein 0.737 0.653 0.544 8e-45
395529739283 PREDICTED: U11/U12 small nuclear ribonuc 0.728 0.579 0.545 1e-44
50756329263 PREDICTED: U11/U12 small nuclear ribonuc 0.737 0.631 0.532 3e-44
326929594265 PREDICTED: u11/U12 small nuclear ribonuc 0.737 0.626 0.526 5e-44
350536563265 putative U11/U12 snRNP 35K [Taeniopygia 0.737 0.626 0.532 8e-44
126324312261 PREDICTED: u11/U12 small nuclear ribonuc 0.728 0.628 0.533 8e-44
224161968265 PREDICTED: U11/U12 small nuclear ribonuc 0.728 0.618 0.539 1e-43
322798651178 hypothetical protein SINV_12300 [Solenop 0.72 0.910 0.521 1e-43
>gi|193631809|ref|XP_001951817.1| PREDICTED: u11/U12 small nuclear ribonucleoprotein 35 kDa protein-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  190 bits (483), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 89/168 (52%), Positives = 116/168 (69%), Gaps = 1/168 (0%)

Query: 42  VKYWYPYCITYDPIQAGSIDGTDTIPHDRAILRALRSTYK-PHTSSTDPTRTLFIGRLNK 100
           VK WYP  I YD I+AGSIDGTD  PHD  I RAL S YK  + +  +P  T+F+GRL+ 
Sbjct: 15  VKCWYPKAIVYDAIKAGSIDGTDIEPHDAGITRALNSNYKISYKAKGNPLNTIFVGRLSL 74

Query: 101 NSREADLEQAFAEYGKVISVRVVRDFVTGHSKRYGFLEYDCEKACLAAIRALNRQNFQGS 160
           ++ E DLE  F  YGK+I++R+V+D +TG SKRY F+EY+  K  L       +   + S
Sbjct: 75  DTTEKDLENEFCRYGKMIALRLVKDLITGLSKRYAFIEYETFKMALNTYVLCKKLVLKNS 134

Query: 161 EIIVDFECGRVLPGWKPRRLGGGWGGNRNSGQLRFGGRNKPWVKPVQL 208
           ++ VDFECGR+LPGWKPRRLGGG+GG + SGQLRFGGR + +  P+ L
Sbjct: 135 QVFVDFECGRLLPGWKPRRLGGGFGGEKQSGQLRFGGRVRCFRPPLNL 182




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|321460332|gb|EFX71375.1| hypothetical protein DAPPUDRAFT_308886 [Daphnia pulex] Back     alignment and taxonomy information
>gi|449279308|gb|EMC86943.1| U11/U12 small nuclear ribonucleoprotein 35 kDa protein [Columba livia] Back     alignment and taxonomy information
>gi|395529739|ref|XP_003766966.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 35 kDa protein-like [Sarcophilus harrisii] Back     alignment and taxonomy information
>gi|50756329|ref|XP_415114.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 35 kDa protein [Gallus gallus] Back     alignment and taxonomy information
>gi|326929594|ref|XP_003210944.1| PREDICTED: u11/U12 small nuclear ribonucleoprotein 35 kDa protein-like [Meleagris gallopavo] Back     alignment and taxonomy information
>gi|350536563|ref|NP_001232485.1| putative U11/U12 snRNP 35K [Taeniopygia guttata] gi|197128442|gb|ACH44940.1| putative U11/U12 snRNP 35K [Taeniopygia guttata] gi|197128443|gb|ACH44941.1| putative U11/U12 snRNP 35K [Taeniopygia guttata] gi|197128444|gb|ACH44942.1| putative U11/U12 snRNP 35K [Taeniopygia guttata] gi|197128445|gb|ACH44943.1| putative U11/U12 snRNP 35K [Taeniopygia guttata] Back     alignment and taxonomy information
>gi|126324312|ref|XP_001375255.1| PREDICTED: u11/U12 small nuclear ribonucleoprotein 35 kDa protein-like [Monodelphis domestica] Back     alignment and taxonomy information
>gi|224161968|ref|XP_002188436.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 35 kDa protein-like [Taeniopygia guttata] Back     alignment and taxonomy information
>gi|322798651|gb|EFZ20255.1| hypothetical protein SINV_12300 [Solenopsis invicta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query225
UNIPROTKB|F1NJ85245 SNRNP35 "Uncharacterized prote 0.737 0.677 0.461 9.5e-34
RGD|1310724244 Snrnp35 "small nuclear ribonuc 0.728 0.672 0.442 2.3e-32
UNIPROTKB|Q5U1W5244 Snrnp35 "U11/U12 small nuclear 0.728 0.672 0.442 2.3e-32
UNIPROTKB|Q1LZH0245 SNRNP35 "U11/U12 small nuclear 0.728 0.669 0.436 4.7e-32
MGI|MGI:1923417244 Snrnp35 "small nuclear ribonuc 0.728 0.672 0.436 6e-32
UNIPROTKB|I3LN96246 SNRNP35 "Uncharacterized prote 0.728 0.666 0.436 1.3e-31
UNIPROTKB|F1P6U2246 SNRNP35 "Uncharacterized prote 0.728 0.666 0.430 1.6e-31
UNIPROTKB|Q16560246 SNRNP35 "U11/U12 small nuclear 0.728 0.666 0.430 3.3e-31
ZFIN|ZDB-GENE-050706-77208 snrnp35 "small nuclear ribonuc 0.746 0.807 0.414 1.8e-30
TAIR|locus:2058141 333 AT2G43370 [Arabidopsis thalian 0.795 0.537 0.381 1.7e-27
UNIPROTKB|F1NJ85 SNRNP35 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 367 (134.2 bits), Expect = 9.5e-34, P = 9.5e-34
 Identities = 77/167 (46%), Positives = 98/167 (58%)

Query:    45 WYPYCITYDPIQAGSIDGTDTIPHDRAILRALRSTYKPHTSST-DPTRTLFIGRLNKNSR 103
             W P    YDP++AGSIDGTD  PHDRAI RA+ + Y P+   T DP  TLF+ RLN  + 
Sbjct:     9 WAPIAKEYDPLKAGSIDGTDEEPHDRAIWRAMLARYVPNKGVTGDPHLTLFVARLNLQTT 68

Query:   104 EADLEQAFAEYGKVISVRVVRDFVTGHSKRYGFLEYDCEKACLAAIRALNRQNFQGSEII 163
             E  L++ F+ YG +  +R+VRD VTG SK Y F+EY  E+A L A R  NR      E+ 
Sbjct:    69 EEKLKEVFSRYGDIRKIRLVRDLVTGFSKGYAFIEYKEERALLKAHRDANRLVIDQHEVF 128

Query:   164 VDFECGRVXXXXXXXXXXXXXXXNRNSGQLRFGGRNKPWVKPVQLMN 210
             VDFE  R                 + SGQLRFGGR++P+ KP+ L N
Sbjct:   129 VDFELERTLKGWIPRRLGGGFGGKKESGQLRFGGRDRPFRKPINLPN 175




GO:0000166 "nucleotide binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005689 "U12-type spliceosomal complex" evidence=IEA
RGD|1310724 Snrnp35 "small nuclear ribonucleoprotein 35 (U11/U12)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q5U1W5 Snrnp35 "U11/U12 small nuclear ribonucleoprotein 35 kDa protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q1LZH0 SNRNP35 "U11/U12 small nuclear ribonucleoprotein 35 kDa protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1923417 Snrnp35 "small nuclear ribonucleoprotein 35 (U11/U12)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|I3LN96 SNRNP35 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1P6U2 SNRNP35 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q16560 SNRNP35 "U11/U12 small nuclear ribonucleoprotein 35 kDa protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050706-77 snrnp35 "small nuclear ribonucleoprotein 35 (U11/U12)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
TAIR|locus:2058141 AT2G43370 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q1LZH0U1SBP_BOVINNo assigned EC number0.50900.72880.6693yesN/A
Q9D384U1SBP_MOUSENo assigned EC number0.50900.72880.6721yesN/A
Q4KMD3U1SBP_DANRENo assigned EC number0.49110.74660.8076yesN/A
Q16560U1SBP_HUMANNo assigned EC number0.50300.72880.6666yesN/A
Q5U1W5U1SBP_RATNo assigned EC number0.51510.72880.6721yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query225
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 3e-39
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 4e-23
smart0036073 smart00360, RRM, RNA recognition motif 1e-21
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 6e-18
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 2e-17
pfam0007670 pfam00076, RRM_1, RNA recognition motif 2e-16
cd1223583 cd12235, RRM_PPIL4, RNA recognition motif in pepti 4e-16
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 3e-15
cd1234366 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 6e-15
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 7e-14
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 1e-13
cd1233583 cd12335, RRM2_SF3B4, RNA recognition motif 2 in sp 2e-12
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 2e-12
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 2e-12
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 2e-12
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 8e-12
cd1237880 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in 1e-11
cd1224371 cd12243, RRM1_MSSP, RNA recognition motif 1 in the 1e-11
PLN03134144 PLN03134, PLN03134, glycine-rich RNA-binding prote 3e-11
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 9e-11
cd1244980 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in 1e-10
cd1235375 cd12353, RRM2_TIA1_like, RNA recognition motif 2 i 1e-10
cd1267175 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif i 1e-10
cd1241774 cd12417, RRM_SAFB_like, RNA recognition motif in t 1e-10
cd1238977 cd12389, RRM2_RAVER, RNA recognition motif 2 in ri 2e-10
cd1222678 cd12226, RRM_NOL8, RNA recognition motif in nucleo 3e-10
cd1234481 cd12344, RRM1_SECp43_like, RNA recognition motif 1 3e-10
cd1255277 cd12552, RRM_Nop15p, RNA recognition motif in yeas 7e-10
cd1241189 cd12411, RRM_ist3_like, RNA recognition motif in i 1e-09
cd1263780 cd12637, RRM2_FCA, RNA recognition motif 2 in plan 1e-09
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 2e-09
cd1232488 cd12324, RRM_RBM8, RNA recognition motif in RNA-bi 3e-09
cd1245480 cd12454, RRM2_RIM4_like, RNA recognition motif 2 i 3e-09
cd1265279 cd12652, RRM2_Hu, RNA recognition motif 2 in the H 3e-09
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 5e-09
cd1265078 cd12650, RRM1_Hu, RNA recognition motif 1 in the H 5e-09
cd1263979 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 6e-09
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 6e-09
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 1e-08
cd1231384 cd12313, RRM1_RRM2_RBM5_like, RNA recognition moti 1e-08
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 1e-08
cd1245077 cd12450, RRM1_NUCLs, RNA recognition motif 1 found 1e-08
cd1237778 cd12377, RRM3_Hu, RNA recognition motif 3 in the H 1e-08
cd1277681 cd12776, RRM2_HuC, RNA recognition motif 2 in vert 1e-08
cd1277481 cd12774, RRM2_HuD, RNA recognition motif 2 in vert 2e-08
cd1237679 cd12376, RRM2_Hu_like, RNA recognition motif 2 in 2e-08
cd1228373 cd12283, RRM1_RBM39_like, RNA recognition motif 1 2e-08
TIGR01661 352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 2e-08
cd1265179 cd12651, RRM2_SXL, RNA recognition motif 2 in Dros 3e-08
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 3e-08
cd1256679 cd12566, RRM2_MRD1, RNA recognition motif 2 in yea 3e-08
cd1264079 cd12640, RRM3_Bruno_like, RNA recognition motif 3 4e-08
cd1277590 cd12775, RRM2_HuB, RNA recognition motif 2 in vert 4e-08
cd1237177 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U 4e-08
cd1230774 cd12307, RRM_NIFK_like, RNA recognition motif in n 6e-08
cd1237076 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U 7e-08
cd1236681 cd12366, RRM1_RBM45, RNA recognition motif 1 in RN 9e-08
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 1e-07
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 1e-07
TIGR01622 457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 2e-07
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 2e-07
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 2e-07
cd1231284 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif 2e-07
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 2e-07
pfam1389356 pfam13893, RRM_5, RNA recognition motif 3e-07
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 3e-07
cd1232873 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 3e-07
cd1232679 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 fou 3e-07
cd1237276 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif 4e-07
cd1263892 cd12638, RRM3_CELF1_2, RNA recognition motif 3 in 4e-07
cd1263287 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 4e-07
cd1240678 cd12406, RRM4_NCL, RNA recognition motif 4 in vert 6e-07
cd1263681 cd12636, RRM2_Bruno_like, RNA recognition motif 2 6e-07
cd1263380 cd12633, RRM1_FCA, RNA recognition motif 1 in plan 7e-07
TIGR01661 352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 8e-07
cd1224479 cd12244, RRM2_MSSP, RNA recognition motif 2 in the 8e-07
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 8e-07
TIGR01661352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 9e-07
cd1261880 cd12618, RRM2_TIA1, RNA recognition motif 2 in nuc 9e-07
cd1276981 cd12769, RRM1_HuR, RNA recognition motif 1 in vert 9e-07
cd1222981 cd12229, RRM_G3BP, RNA recognition motif (RRM) in 1e-06
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 1e-06
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 1e-06
cd1261780 cd12617, RRM2_TIAR, RNA recognition motif 2 in nuc 1e-06
cd1257776 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in ye 2e-06
cd1240074 cd12400, RRM_Nop6, RNA recognition motif in Saccha 2e-06
cd1260667 cd12606, RRM1_RBM4, RNA recognition motif 1 in ver 2e-06
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 2e-06
cd1235074 cd12350, RRM3_SHARP, RNA recognition motif 3 in SM 2e-06
cd1267874 cd12678, RRM_SLTM, RNA recognition motif in Scaffo 3e-06
cd1259474 cd12594, RRM1_SRSF4, RNA recognition motif 1 in ve 4e-06
cd1260869 cd12608, RRM1_CoAA, RNA recognition motif 1 in ver 4e-06
cd1238383 cd12383, RRM_RBM42, RNA recognition motif in RNA-b 4e-06
TIGR01622 457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 5e-06
cd1234580 cd12345, RRM2_SECp43_like, RNA recognition motif 2 5e-06
cd1227371 cd12273, RRM1_NEFsp, RNA recognition motif 1 in ve 5e-06
cd1237977 cd12379, RRM2_I_PABPs, RNA recognition motif 2 fou 6e-06
cd1260968 cd12609, RRM2_CoAA, RNA recognition motif 2 in ver 6e-06
cd1235873 cd12358, RRM1_VICKZ, RNA recognition motif 1 in th 6e-06
cd1263184 cd12631, RRM1_CELF1_2_Bruno, RNA recognition motif 7e-06
cd1277183 cd12771, RRM1_HuB, RNA recognition motif 1 in vert 7e-06
cd1232572 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition 7e-06
cd1234168 cd12341, RRM_hnRNPC_like, RNA recognition motif in 8e-06
cd1241280 cd12412, RRM_DAZL_BOULE, RNA recognition motif in 9e-06
cd1259670 cd12596, RRM1_SRSF6, RNA recognition motif 1 in ve 9e-06
cd1265384 cd12653, RRM3_HuR, RNA recognition motif 3 in vert 9e-06
cd1263581 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 1e-05
cd1267976 cd12679, RRM_SAFB1_SAFB2, RNA recognition motif in 1e-05
cd1223370 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition m 1e-05
cd1267479 cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye 1e-05
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 1e-05
cd1232780 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in D 2e-05
cd1257878 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 2e-05
cd1230673 cd12306, RRM_II_PABPs, RNA recognition motif in ty 2e-05
cd1239172 cd12391, RRM1_SART3, RNA recognition motif 1 in sq 2e-05
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 2e-05
cd1277384 cd12773, RRM2_HuR, RNA recognition motif 2 in vert 2e-05
cd1277083 cd12770, RRM1_HuD, RNA recognition motif 1 in vert 2e-05
cd1246670 cd12466, RRM2_AtRSp31_like, RNA recognition motif 2e-05
TIGR01645 612 TIGR01645, half-pint, poly-U binding splicing fact 2e-05
cd1232076 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition mot 2e-05
cd1277284 cd12772, RRM1_HuC, RNA recognition motif 1 in vert 2e-05
cd1233075 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in ye 2e-05
cd1233770 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 3e-05
cd1265585 cd12655, RRM3_HuC, RNA recognition motif 3 in vert 3e-05
cd1257379 cd12573, RRM2_MSI2, RNA recognition motif 2 in RNA 3e-05
cd1247175 cd12471, RRM1_MSSP2, RNA recognition motif 1 in ve 3e-05
cd1267381 cd12673, RRM_BOULE, RNA recognition motif in prote 3e-05
cd1264981 cd12649, RRM1_SXL, RNA recognition motif 1 in Dros 3e-05
cd1261084 cd12610, RRM1_SECp43, RNA recognition motif 1 in t 4e-05
cd1236078 cd12360, RRM_cwf2, RNA recognition motif in yeast 4e-05
cd1261975 cd12619, RRM2_PUB1, RNA recognition motif 2 in yea 4e-05
cd1233474 cd12334, RRM1_SF3B4, RNA recognition motif 1 in sp 4e-05
cd1258180 cd12581, RRM2_hnRNPA2B1, RNA recognition motif 2 i 4e-05
cd1265686 cd12656, RRM3_HuD, RNA recognition motif 3 in vert 5e-05
cd1224273 cd12242, RRM_SLIRP, RNA recognition motif found in 5e-05
cd1244684 cd12446, RRM_RBM25, RNA recognition motif in eukar 5e-05
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 6e-05
cd1230979 cd12309, RRM2_Spen, RNA recognition motif 2 in the 6e-05
cd1232177 cd12321, RRM1_TDP43, RNA recognition motif 1 in TA 6e-05
cd1249472 cd12494, RRM3_hnRNPR, RNA recognition motif 3 in v 6e-05
cd1247086 cd12470, RRM1_MSSP1, RNA recognition motif 1 in ve 6e-05
cd1256084 cd12560, RRM_SRSF12, RNA recognition motif in seri 6e-05
cd1261574 cd12615, RRM1_TIA1, RNA recognition motif 1 in nuc 7e-05
cd1265486 cd12654, RRM3_HuB, RNA recognition motif 3 in vert 7e-05
cd1231173 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in 9e-05
cd1227671 cd12276, RRM2_MEI2_EAR1_like, RNA recognition moti 1e-04
cd1255177 cd12551, RRM_II_PABPN1L, RNA recognition motif in 1e-04
cd1236774 cd12367, RRM2_RBM45, RNA recognition motif 2 in RN 1e-04
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 1e-04
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 1e-04
cd1248478 cd12484, RRM1_RBM46, RNA recognition motif 1 found 1e-04
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 2e-04
cd1261380 cd12613, RRM2_NGR1_NAM8_like, RNA recognition moti 2e-04
cd1240176 cd12401, RRM_eIF4H, RNA recognition motif in eukar 2e-04
cd1255685 cd12556, RRM2_RBM15B, RNA recognition motif 2 in p 2e-04
cd1267282 cd12672, RRM_DAZL, RNA recognition motif in verteb 2e-04
cd1236481 cd12364, RRM_RDM1, RNA recognition motif of RAD52 2e-04
cd1259375 cd12593, RRM_RBM11, RNA recognition motif in verte 2e-04
cd1231072 cd12310, RRM3_Spen, RNA recognition motif 3 in the 2e-04
cd1249572 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in v 2e-04
cd1232374 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA- 3e-04
cd1224978 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 3e-04
cd1259570 cd12595, RRM1_SRSF5, RNA recognition motif 1 in ve 3e-04
cd1233675 cd12336, RRM_RBM7_like, RNA recognition motif in R 3e-04
cd1247486 cd12474, RRM2_MSSP2, RNA recognition motif 2 found 3e-04
cd1255587 cd12555, RRM2_RBM15, RNA recognition motif 2 in ve 3e-04
cd1263481 cd12634, RRM2_CELF1_2, RNA recognition motif 2 in 3e-04
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 3e-04
cd1276381 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in 4e-04
cd1256576 cd12565, RRM1_MRD1, RNA recognition motif 1 in yea 4e-04
cd1247280 cd12472, RRM1_RBMS3, RNA recognition motif 1 found 4e-04
cd1255984 cd12559, RRM_SRSF10, RNA recognition motif in seri 4e-04
cd1241698 cd12416, RRM4_RBM28_like, RNA recognition motif 4 4e-04
cd1253785 cd12537, RRM1_RBM23, RNA recognition motif 1 in ve 4e-04
cd1259275 cd12592, RRM_RBM7, RNA recognition motif in verteb 4e-04
cd1247385 cd12473, RRM2_MSSP1, RNA recognition motif 2 found 5e-04
cd1256779 cd12567, RRM3_RBM19, RNA recognition motif 3 in RN 5e-04
cd1229080 cd12290, RRM1_LARP7, RNA recognition motif 1 in La 5e-04
cd1241875 cd12418, RRM_Aly_REF_like, RNA recognition motif i 6e-04
cd1223472 cd12234, RRM1_AtRSp31_like, RNA recognition motif 6e-04
cd1222777 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in 6e-04
cd1232975 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 6e-04
cd1260569 cd12605, RRM_RALYL, RNA recognition motif in verte 6e-04
cd1260767 cd12607, RRM2_RBM4, RNA recognition motif 2 in ver 6e-04
TIGR01642509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 8e-04
cd1240776 cd12407, RRM_FOX1_like, RNA recognition motif in v 0.001
cd1253685 cd12536, RRM1_RBM39, RNA recognition motif 1 in ve 0.001
cd1231577 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 0.001
cd1276281 cd12762, RRM1_hnRNPA2B1, RNA recognition motif 1 i 0.001
cd1257980 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in 0.001
cd1223177 cd12231, RRM2_U2AF65, RNA recognition motif 2 foun 0.001
cd1257574 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 0.001
cd1257274 cd12572, RRM2_MSI1, RNA recognition motif 2 in RNA 0.001
cd1252971 cd12529, RRM2_MEI2_like, RNA recognition motif 2 i 0.001
TIGR01645 612 TIGR01645, half-pint, poly-U binding splicing fact 0.002
cd1261474 cd12614, RRM1_PUB1, RNA recognition motif 1 in yea 0.002
cd1257076 cd12570, RRM5_MRD1, RNA recognition motif 5 in yea 0.002
cd1235272 cd12352, RRM1_TIA1_like, RNA recognition motif 1 i 0.002
cd1222474 cd12224, RRM_RBM22, RNA recognition motif (RRM) fo 0.002
cd1264581 cd12645, RRM_SRSF3, RNA recognition motif in verte 0.002
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 0.002
cd1238179 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in 0.002
cd1259972 cd12599, RRM1_SF2_plant_like, RNA recognition moti 0.003
cd1275674 cd12756, RRM1_hnRNPD, RNA recognition motif 1 in h 0.003
cd1247588 cd12475, RRM2_RBMS3, RNA recognition motif 2 found 0.003
cd1233179 cd12331, RRM_NRD1_SEB1_like, RNA recognition motif 0.003
cd1258280 cd12582, RRM2_hnRNPA3, RNA recognition motif 2 in 0.004
TIGR01659 346 TIGR01659, sex-lethal, sex-lethal family splicing 0.004
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 0.004
cd1262274 cd12622, RRM3_PUB1, RNA recognition motif 3 in yea 0.004
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
 Score =  130 bits (328), Expect = 3e-39
 Identities = 47/93 (50%), Positives = 60/93 (64%)

Query: 88  DPTRTLFIGRLNKNSREADLEQAFAEYGKVISVRVVRDFVTGHSKRYGFLEYDCEKACLA 147
           DP  TLF+GRL+  + E  L + F+ YG +  +R+VRD VTG SK Y F+EY+ E+  L 
Sbjct: 1   DPYLTLFVGRLSLQTTEETLREVFSRYGDIRRLRLVRDIVTGFSKGYAFVEYEHERDALR 60

Query: 148 AIRALNRQNFQGSEIIVDFECGRVLPGWKPRRL 180
           A R  ++    GSEI VDFE  R LPGW PRRL
Sbjct: 61  AYRDAHKLVIDGSEIFVDFERERTLPGWIPRRL 93


This subfamily corresponds to the RRM of U11/U12-35K, also termed protein HM-1, or U1 snRNP-binding protein homolog, and is one of the components of the U11/U12 snRNP, which is a subunit of the minor (U12-dependent) spliceosome required for splicing U12-type nuclear pre-mRNA introns. U11/U12-35K is highly conserved among bilateria and plants, but lacks in some organisms, such as Saccharomyces cerevisiae and Caenorhabditis elegans. Moreover, U11/U12-35K shows significant sequence homology to U1 snRNP-specific 70 kDa protein (U1-70K or snRNP70). It contains a conserved RNA recognition motif (RRM), also termed RBD (RNA binding domain) or RNP (ribonucleoprotein domain), followed by an adjacent glycine-rich region, and Arg-Asp and Arg-Glu dipeptide repeats rich domain, making U11/U12-35K a possible functional analog of U1-70K. It may facilitate 5' splice site recognition in the minor spliceosome and play a role in exon bridging, interacting with components of the major spliceosome bound to the pyrimidine tract of an upstream U2-type intron. The family corresponds to the RRM of U11/U12-35K that may directly contact the U11 or U12 snRNA through the RRM domain. Length = 93

>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240681 cd12235, RRM_PPIL4, RNA recognition motif in peptidyl-prolyl cis-trans isomerase-like 4 (PPIase) and similar proteins Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|240781 cd12335, RRM2_SF3B4, RNA recognition motif 2 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240689 cd12243, RRM1_MSSP, RNA recognition motif 1 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins Back     alignment and domain information
>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), cleavage stimulation factor subunit 2 tau variant (CSTF2T) and similar proteins Back     alignment and domain information
>gnl|CDD|240863 cd12417, RRM_SAFB_like, RNA recognition motif in the scaffold attachment factor (SAFB) family Back     alignment and domain information
>gnl|CDD|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240672 cd12226, RRM_NOL8, RNA recognition motif in nucleolar protein 8 (NOL8) and similar proteins Back     alignment and domain information
>gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|240996 cd12552, RRM_Nop15p, RNA recognition motif in yeast ribosome biogenesis protein 15 (Nop15p) and similar proteins Back     alignment and domain information
>gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family Back     alignment and domain information
>gnl|CDD|241081 cd12637, RRM2_FCA, RNA recognition motif 2 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|240770 cd12324, RRM_RBM8, RNA recognition motif in RNA-binding protein RBM8A, RBM8B nd similar proteins Back     alignment and domain information
>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|241096 cd12652, RRM2_Hu, RNA recognition motif 2 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|241094 cd12650, RRM1_Hu, RNA recognition motif 1 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|241083 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|241220 cd12776, RRM2_HuC, RNA recognition motif 2 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|241218 cd12774, RRM2_HuD, RNA recognition motif 2 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|240822 cd12376, RRM2_Hu_like, RNA recognition motif 2 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240729 cd12283, RRM1_RBM39_like, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|241095 cd12651, RRM2_SXL, RNA recognition motif 2 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|241084 cd12640, RRM3_Bruno_like, RNA recognition motif 3 in Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|241219 cd12775, RRM2_HuB, RNA recognition motif 2 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar protein interacting with the FHA domain of pKI-67 (NIFK) and similar proteins Back     alignment and domain information
>gnl|CDD|240816 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240812 cd12366, RRM1_RBM45, RNA recognition motif 1 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor SRSF10, SRSF12 and similar proteins Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240772 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 found in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|240818 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif of pre-mRNA cleavage factor Im 68 kDa subunit (CFIm68 or CPSF6), pre-mRNA cleavage factor Im 59 kDa subunit (CFIm59 or CPSF7), and similar proteins Back     alignment and domain information
>gnl|CDD|241082 cd12638, RRM3_CELF1_2, RNA recognition motif 3 in CUGBP Elav-like family member CELF-1, CELF-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241076 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|240852 cd12406, RRM4_NCL, RNA recognition motif 4 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|241080 cd12636, RRM2_Bruno_like, RNA recognition motif 2 in Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|241077 cd12633, RRM1_FCA, RNA recognition motif 1 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|240690 cd12244, RRM2_MSSP, RNA recognition motif 2 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|241062 cd12618, RRM2_TIA1, RNA recognition motif 2 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241213 cd12769, RRM1_HuR, RNA recognition motif 1 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|240675 cd12229, RRM_G3BP, RNA recognition motif (RRM) in ras GTPase-activating protein-binding protein G3BP1, G3BP2 and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|241061 cd12617, RRM2_TIAR, RNA recognition motif 2 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|241021 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240846 cd12400, RRM_Nop6, RNA recognition motif in Saccharomyces cerevisiae nucleolar protein 6 (Nop6) and similar proteins Back     alignment and domain information
>gnl|CDD|241050 cd12606, RRM1_RBM4, RNA recognition motif 1 in vertebrate RNA-binding protein 4 (RBM4) Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240796 cd12350, RRM3_SHARP, RNA recognition motif 3 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|241122 cd12678, RRM_SLTM, RNA recognition motif in Scaffold attachment factor (SAF)-like transcription modulator (SLTM) and similar proteins Back     alignment and domain information
>gnl|CDD|241038 cd12594, RRM1_SRSF4, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 4 (SRSF4) Back     alignment and domain information
>gnl|CDD|241052 cd12608, RRM1_CoAA, RNA recognition motif 1 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|240829 cd12383, RRM_RBM42, RNA recognition motif in RNA-binding protein 42 (RBM42) and similar proteins Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|240791 cd12345, RRM2_SECp43_like, RNA recognition motif 2 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|240719 cd12273, RRM1_NEFsp, RNA recognition motif 1 in vertebrate putative RNA exonuclease NEF-sp Back     alignment and domain information
>gnl|CDD|240825 cd12379, RRM2_I_PABPs, RNA recognition motif 2 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241053 cd12609, RRM2_CoAA, RNA recognition motif 2 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|240804 cd12358, RRM1_VICKZ, RNA recognition motif 1 in the VICKZ family proteins Back     alignment and domain information
>gnl|CDD|241075 cd12631, RRM1_CELF1_2_Bruno, RNA recognition motif 1 in CUGBP Elav-like family member CELF-1, CELF-2, Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|241215 cd12771, RRM1_HuB, RNA recognition motif 1 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins Back     alignment and domain information
>gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins Back     alignment and domain information
>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE Back     alignment and domain information
>gnl|CDD|241040 cd12596, RRM1_SRSF6, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 6 (SRSF6) Back     alignment and domain information
>gnl|CDD|241097 cd12653, RRM3_HuR, RNA recognition motif 3 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|241079 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|241123 cd12679, RRM_SAFB1_SAFB2, RNA recognition motif in scaffold attachment factor B1 (SAFB1), scaffold attachment factor B2 (SAFB2), and similar proteins Back     alignment and domain information
>gnl|CDD|240679 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition motif found in fission yeast pre-mRNA-splicing factor Srp1p, Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins Back     alignment and domain information
>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|240773 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|241022 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|241217 cd12773, RRM2_HuR, RNA recognition motif 2 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|241214 cd12770, RRM1_HuD, RNA recognition motif 1 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|240912 cd12466, RRM2_AtRSp31_like, RNA recognition motif 2 in Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins from plants Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|240766 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition motif 6 in RNA-binding protein 19 (RBM19 or RBD-1) and RNA recognition motif 5 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|241216 cd12772, RRM1_HuC, RNA recognition motif 1 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|240776 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240783 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 4 (SRSF4) and similar proteins Back     alignment and domain information
>gnl|CDD|241099 cd12655, RRM3_HuC, RNA recognition motif 3 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|241017 cd12573, RRM2_MSI2, RNA recognition motif 2 in RNA-binding protein Musashi homolog 2 (Musashi-2) and similar proteins Back     alignment and domain information
>gnl|CDD|240915 cd12471, RRM1_MSSP2, RNA recognition motif 1 in vertebrate single-stranded DNA-binding protein MSSP-2 Back     alignment and domain information
>gnl|CDD|241117 cd12673, RRM_BOULE, RNA recognition motif in protein BOULE Back     alignment and domain information
>gnl|CDD|241093 cd12649, RRM1_SXL, RNA recognition motif 1 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|241054 cd12610, RRM1_SECp43, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) Back     alignment and domain information
>gnl|CDD|240806 cd12360, RRM_cwf2, RNA recognition motif in yeast pre-mRNA-splicing factor Cwc2 and similar proteins Back     alignment and domain information
>gnl|CDD|241063 cd12619, RRM2_PUB1, RNA recognition motif 2 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|240780 cd12334, RRM1_SF3B4, RNA recognition motif 1 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|241025 cd12581, RRM2_hnRNPA2B1, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1) and similar proteins Back     alignment and domain information
>gnl|CDD|241100 cd12656, RRM3_HuD, RNA recognition motif 3 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|240688 cd12242, RRM_SLIRP, RNA recognition motif found in SRA stem-loop-interacting RNA-binding protein (SLIRP) and similar proteins Back     alignment and domain information
>gnl|CDD|240892 cd12446, RRM_RBM25, RNA recognition motif in eukaryotic RNA-binding protein 25 and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240755 cd12309, RRM2_Spen, RNA recognition motif 2 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|240767 cd12321, RRM1_TDP43, RNA recognition motif 1 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|240938 cd12494, RRM3_hnRNPR, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein R (hnRNP R) Back     alignment and domain information
>gnl|CDD|240914 cd12470, RRM1_MSSP1, RNA recognition motif 1 in vertebrate single-stranded DNA-binding protein MSSP-1 Back     alignment and domain information
>gnl|CDD|241004 cd12560, RRM_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor 12 (SRSF12) and similar proteins Back     alignment and domain information
>gnl|CDD|241059 cd12615, RRM1_TIA1, RNA recognition motif 1 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241098 cd12654, RRM3_HuB, RNA recognition motif 3 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in serine/arginine-rich splicing factor SRSF2, SRSF8 and similar proteins Back     alignment and domain information
>gnl|CDD|240722 cd12276, RRM2_MEI2_EAR1_like, RNA recognition motif 2 in Mei2-like proteins and terminal EAR1-like proteins Back     alignment and domain information
>gnl|CDD|240995 cd12551, RRM_II_PABPN1L, RNA recognition motif in vertebrate type II embryonic polyadenylate-binding protein 2 (ePABP-2) Back     alignment and domain information
>gnl|CDD|240813 cd12367, RRM2_RBM45, RNA recognition motif 2 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
>gnl|CDD|240928 cd12484, RRM1_RBM46, RNA recognition motif 1 found in vertebrate RNA-binding protein 46 (RBM46) Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|241057 cd12613, RRM2_NGR1_NAM8_like, RNA recognition motif 2 in yeast negative growth regulatory protein NGR1, yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|240847 cd12401, RRM_eIF4H, RNA recognition motif in eukaryotic translation initiation factor 4H (eIF-4H) and similar proteins Back     alignment and domain information
>gnl|CDD|241000 cd12556, RRM2_RBM15B, RNA recognition motif 2 in putative RNA binding motif protein 15B (RBM15B) from vertebrate Back     alignment and domain information
>gnl|CDD|241116 cd12672, RRM_DAZL, RNA recognition motif in vertebrate deleted in azoospermia-like (DAZL) proteins Back     alignment and domain information
>gnl|CDD|240810 cd12364, RRM_RDM1, RNA recognition motif of RAD52 motif-containing protein 1 (RDM1) and similar proteins Back     alignment and domain information
>gnl|CDD|241037 cd12593, RRM_RBM11, RNA recognition motif in vertebrate RNA-binding protein 11 (RBM11) Back     alignment and domain information
>gnl|CDD|240756 cd12310, RRM3_Spen, RNA recognition motif 3 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|240939 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) Back     alignment and domain information
>gnl|CDD|240769 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA-binding protein Musashi homologs Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240695 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|241039 cd12595, RRM1_SRSF5, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 5 (SRSF5) Back     alignment and domain information
>gnl|CDD|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding protein 7 (RBM7) and similar proteins Back     alignment and domain information
>gnl|CDD|240918 cd12474, RRM2_MSSP2, RNA recognition motif 2 found in vertebrate single-stranded DNA-binding protein MSSP-2 Back     alignment and domain information
>gnl|CDD|240999 cd12555, RRM2_RBM15, RNA recognition motif 2 in vertebrate RNA binding motif protein 15 (RBM15) Back     alignment and domain information
>gnl|CDD|241078 cd12634, RRM2_CELF1_2, RNA recognition motif 2 in CUGBP Elav-like family member CELF-1, CELF-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|241207 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3) and similar proteins Back     alignment and domain information
>gnl|CDD|241009 cd12565, RRM1_MRD1, RNA recognition motif 1 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240916 cd12472, RRM1_RBMS3, RNA recognition motif 1 found in vertebrate RNA-binding motif, single-stranded-interacting protein 3 (RBMS3) Back     alignment and domain information
>gnl|CDD|241003 cd12559, RRM_SRSF10, RNA recognition motif in serine/arginine-rich splicing factor 10 (SRSF10) and similar proteins Back     alignment and domain information
>gnl|CDD|240862 cd12416, RRM4_RBM28_like, RNA recognition motif 4 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240981 cd12537, RRM1_RBM23, RNA recognition motif 1 in vertebrate probable RNA-binding protein 23 (RBM23) Back     alignment and domain information
>gnl|CDD|241036 cd12592, RRM_RBM7, RNA recognition motif in vertebrate RNA-binding protein 7 (RBM7) Back     alignment and domain information
>gnl|CDD|240917 cd12473, RRM2_MSSP1, RNA recognition motif 2 found in vertebrate single-stranded DNA-binding protein MSSP-1 Back     alignment and domain information
>gnl|CDD|241011 cd12567, RRM3_RBM19, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240736 cd12290, RRM1_LARP7, RNA recognition motif 1 in La-related protein 7 (LARP7) and similar proteins Back     alignment and domain information
>gnl|CDD|240864 cd12418, RRM_Aly_REF_like, RNA recognition motif in the Aly/REF family Back     alignment and domain information
>gnl|CDD|240680 cd12234, RRM1_AtRSp31_like, RNA recognition motif in Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins from plants Back     alignment and domain information
>gnl|CDD|240673 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in SR-related and CTD-associated factor 4 (SCAF4), SR-related and CTD-associated factor 8 (SCAF8) and similar proteins Back     alignment and domain information
>gnl|CDD|240775 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|241049 cd12605, RRM_RALYL, RNA recognition motif in vertebrate RNA-binding Raly-like protein (RALYL) Back     alignment and domain information
>gnl|CDD|241051 cd12607, RRM2_RBM4, RNA recognition motif 2 in vertebrate RNA-binding protein 4 (RBM4) Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|240853 cd12407, RRM_FOX1_like, RNA recognition motif in vertebrate RNA binding protein fox-1 homologs and similar proteins Back     alignment and domain information
>gnl|CDD|240980 cd12536, RRM1_RBM39, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) Back     alignment and domain information
>gnl|CDD|240761 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 in RNA-binding protein 19 (RBM19), yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|241206 cd12762, RRM1_hnRNPA2B1, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1) and similar proteins Back     alignment and domain information
>gnl|CDD|241023 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|240677 cd12231, RRM2_U2AF65, RNA recognition motif 2 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|241019 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|241016 cd12572, RRM2_MSI1, RNA recognition motif 2 in RNA-binding protein Musashi homolog 1 (Musashi-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240973 cd12529, RRM2_MEI2_like, RNA recognition motif 2 in plant Mei2-like proteins Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|241058 cd12614, RRM1_PUB1, RNA recognition motif 1 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|241014 cd12570, RRM5_MRD1, RNA recognition motif 5 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240798 cd12352, RRM1_TIA1_like, RNA recognition motif 1 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240670 cd12224, RRM_RBM22, RNA recognition motif (RRM) found in Pre-mRNA-splicing factor RBM22 and similar proteins Back     alignment and domain information
>gnl|CDD|241089 cd12645, RRM_SRSF3, RNA recognition motif in vertebrate serine/arginine-rich splicing factor 3 (SRSF3) Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241043 cd12599, RRM1_SF2_plant_like, RNA recognition motif 1 in plant pre-mRNA-splicing factor SF2 and similar proteins Back     alignment and domain information
>gnl|CDD|241200 cd12756, RRM1_hnRNPD, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) and similar proteins Back     alignment and domain information
>gnl|CDD|240919 cd12475, RRM2_RBMS3, RNA recognition motif 2 found in vertebrate RNA-binding motif, single-stranded-interacting protein 3 (RBMS3) Back     alignment and domain information
>gnl|CDD|240777 cd12331, RRM_NRD1_SEB1_like, RNA recognition motif in Saccharomyces cerevisiae protein Nrd1, Schizosaccharomyces pombe Rpb7-binding protein seb1 and similar proteins Back     alignment and domain information
>gnl|CDD|241026 cd12582, RRM2_hnRNPA3, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3) and similar proteins Back     alignment and domain information
>gnl|CDD|233515 TIGR01659, sex-lethal, sex-lethal family splicing factor Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|241066 cd12622, RRM3_PUB1, RNA recognition motif 3 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 225
KOG0113|consensus335 99.91
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.89
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.86
KOG0121|consensus153 99.75
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.74
KOG0105|consensus 241 99.73
TIGR01659 346 sex-lethal sex-lethal family splicing factor. This 99.72
TIGR01661 352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.71
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.71
KOG0122|consensus270 99.71
KOG0107|consensus195 99.7
KOG4207|consensus 256 99.7
KOG0149|consensus 247 99.66
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.65
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.65
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.63
KOG0125|consensus 376 99.62
PLN03120 260 nucleic acid binding protein; Provisional 99.62
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 99.61
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.6
KOG0130|consensus170 99.59
PLN03213 759 repressor of silencing 3; Provisional 99.58
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.57
KOG0148|consensus321 99.57
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.56
PLN03121 243 nucleic acid binding protein; Provisional 99.55
KOG0148|consensus 321 99.55
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 99.55
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.54
KOG0126|consensus219 99.54
smart0036272 RRM_2 RNA recognition motif. 99.54
KOG0117|consensus 506 99.53
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.53
KOG0415|consensus 479 99.52
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.51
KOG0131|consensus203 99.5
smart0036071 RRM RNA recognition motif. 99.5
KOG0145|consensus 360 99.5
KOG0116|consensus419 99.49
KOG0117|consensus 506 99.49
KOG0111|consensus 298 99.48
KOG0144|consensus 510 99.48
KOG0108|consensus 435 99.47
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.47
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.46
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.45
KOG0114|consensus124 99.44
KOG4212|consensus 608 99.43
KOG0144|consensus 510 99.42
KOG0127|consensus 678 99.42
KOG0127|consensus 678 99.38
KOG0145|consensus360 99.36
KOG0146|consensus371 99.36
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.34
smart0036170 RRM_1 RNA recognition motif. 99.34
KOG0124|consensus 544 99.33
KOG0109|consensus 346 99.32
KOG4208|consensus214 99.3
KOG0147|consensus 549 99.27
KOG0131|consensus203 99.25
KOG4205|consensus311 99.24
KOG0109|consensus 346 99.19
TIGR01642 509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.18
KOG0132|consensus 894 99.16
KOG0123|consensus 369 99.16
KOG4206|consensus221 99.16
KOG4205|consensus 311 99.13
KOG0110|consensus725 99.07
KOG0146|consensus 371 99.07
KOG4212|consensus608 99.06
KOG0533|consensus243 99.05
KOG0153|consensus377 99.04
KOG4661|consensus 940 99.04
KOG0124|consensus 544 99.0
KOG4209|consensus231 98.98
KOG0123|consensus 369 98.98
KOG0110|consensus725 98.97
KOG0106|consensus216 98.9
KOG1548|consensus 382 98.9
KOG1995|consensus 351 98.82
KOG4454|consensus 267 98.8
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 98.75
KOG1457|consensus 284 98.74
KOG0226|consensus290 98.71
KOG0151|consensus 877 98.68
KOG4211|consensus 510 98.64
KOG4660|consensus 549 98.55
KOG4210|consensus285 98.39
KOG0120|consensus500 98.37
KOG4849|consensus 498 98.34
KOG0147|consensus 549 98.32
KOG1190|consensus492 98.27
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 98.14
KOG1457|consensus284 98.13
KOG4206|consensus221 98.07
KOG4211|consensus 510 98.04
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 98.01
KOG3152|consensus278 98.01
KOG0106|consensus216 98.0
KOG0105|consensus241 97.81
KOG1456|consensus 494 97.79
COG5175 480 MOT2 Transcriptional repressor [Transcription] 97.74
KOG1190|consensus492 97.64
KOG0129|consensus520 97.63
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 97.61
KOG4307|consensus944 97.6
KOG1548|consensus382 97.53
KOG0120|consensus500 97.5
KOG2416|consensus 718 97.44
KOG1456|consensus494 97.41
KOG0129|consensus 520 97.4
KOG2314|consensus 698 97.39
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 97.26
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 97.23
KOG1855|consensus 484 97.11
KOG1365|consensus508 97.08
KOG1365|consensus 508 96.92
KOG4676|consensus 479 96.9
KOG0112|consensus 975 96.9
KOG2202|consensus260 96.88
KOG1996|consensus378 96.88
KOG0128|consensus881 96.84
KOG2193|consensus 584 96.75
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 96.72
KOG4307|consensus 944 96.72
KOG0128|consensus881 96.56
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 96.51
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 96.36
KOG0112|consensus 975 95.99
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 95.93
KOG0115|consensus 275 95.87
KOG2253|consensus 668 95.86
KOG2068|consensus 327 95.86
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 95.3
PF15023166 DUF4523: Protein of unknown function (DUF4523) 95.27
PF0388074 DbpA: DbpA RNA binding domain ; InterPro: IPR00558 94.93
KOG2591|consensus 684 94.48
KOG4210|consensus285 94.22
KOG4660|consensus549 94.15
KOG2135|consensus526 93.86
KOG4285|consensus350 93.62
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 93.58
KOG4574|consensus 1007 91.98
PF1176766 SET_assoc: Histone lysine methyltransferase SET as 91.93
KOG2193|consensus 584 89.79
KOG0804|consensus 493 89.54
KOG2318|consensus 650 87.48
KOG4676|consensus 479 87.29
KOG4410|consensus396 82.75
>KOG0113|consensus Back     alignment and domain information
Probab=99.91  E-value=6.6e-24  Score=172.34  Aligned_cols=166  Identities=40%  Similarity=0.708  Sum_probs=138.8

Q ss_pred             CCCccccccccCccccCCCCCcccCcccHHHHHHHhccCCCCC-CCCCCCCeEEEcCCCCCCCHHHHHHHHhcCCceeEE
Q psy222           42 VKYWYPYCITYDPIQAGSIDGTDTIPHDRAILRALRSTYKPHT-SSTDPTRTLFIGRLNKNSREADLEQAFAEYGKVISV  120 (225)
Q Consensus        42 ~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~l~V~nLp~~~te~~L~~~F~~~G~v~~v  120 (225)
                      +..+.+++...++++...++..+..++. ...+.+..+..... ...++-+||||+.|+++++|..|+..|+.||.|..|
T Consensus        53 ~p~~~p~~t~~e~~er~~~~k~e~~~~~-~~~~l~~wdP~~dp~a~gDPy~TLFv~RLnydT~EskLrreF~~YG~Ikri  131 (335)
T KOG0113|consen   53 APPKFPVETPEEPLERGRREKTEKIPHK-LERRLKLWDPNNDPNAIGDPYKTLFVARLNYDTSESKLRREFEKYGPIKRI  131 (335)
T ss_pred             CCCcCcccchhhHHHhhhhhhhhhhHHH-HHHHHHhcCCCCCCcccCCccceeeeeeccccccHHHHHHHHHhcCcceeE
Confidence            3456777777777777777766666664 33333333222222 566889999999999999999999999999999999


Q ss_pred             EEeecCCCCccceEEEEEeCCHHHHHHHHHHhCCCccCCcEEEEEEeeCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCC
Q psy222          121 RVVRDFVTGHSKRYGFLEYDCEKACLAAIRALNRQNFQGSEIIVDFECGRVLPGWKPRRLGGGWGGNR-NSGQLRFGGRN  199 (225)
Q Consensus       121 ~i~~~~~~g~~kg~afV~F~~~~~a~~Al~~l~g~~l~g~~l~V~~a~~~~~~~~~~~r~~gg~gg~~-~~g~~~~gg~~  199 (225)
                      .|++++.||+++|||||+|.++.++.+|.+..+|..|+|+.|.|++-..+..++|.|++.+||.||.+ ..+...++++.
T Consensus       132 rlV~d~vTgkskGYAFIeye~erdm~~AYK~adG~~Idgrri~VDvERgRTvkgW~PRRLGGGLGg~r~~~~~~~~~~R~  211 (335)
T KOG0113|consen  132 RLVRDKVTGKSKGYAFIEYEHERDMKAAYKDADGIKIDGRRILVDVERGRTVKGWLPRRLGGGLGGRRYESRQLRFGGRE  211 (335)
T ss_pred             EEeeecccCCccceEEEEeccHHHHHHHHHhccCceecCcEEEEEecccccccccccccccCCcCCcccccccccccccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999987 45666788888


Q ss_pred             CCCCCCccC
Q psy222          200 KPWVKPVQL  208 (225)
Q Consensus       200 ~~~~~p~~~  208 (225)
                      +++..|...
T Consensus       212 R~~~s~~~g  220 (335)
T KOG0113|consen  212 RPFRSPLNG  220 (335)
T ss_pred             ccccCCCCC
Confidence            887777654



>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0121|consensus Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>KOG0107|consensus Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>KOG0149|consensus Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0130|consensus Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>KOG0116|consensus Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>KOG4208|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0132|consensus Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG0533|consensus Back     alignment and domain information
>KOG0153|consensus Back     alignment and domain information
>KOG4661|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>KOG4209|consensus Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>KOG1995|consensus Back     alignment and domain information
>KOG4454|consensus Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG0226|consensus Back     alignment and domain information
>KOG0151|consensus Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG4849|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG3152|consensus Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG2416|consensus Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG1855|consensus Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>KOG4676|consensus Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>KOG2202|consensus Back     alignment and domain information
>KOG1996|consensus Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>KOG0115|consensus Back     alignment and domain information
>KOG2253|consensus Back     alignment and domain information
>KOG2068|consensus Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] Back     alignment and domain information
>KOG2591|consensus Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>KOG2135|consensus Back     alignment and domain information
>KOG4285|consensus Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>KOG4574|consensus Back     alignment and domain information
>PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information
>KOG2318|consensus Back     alignment and domain information
>KOG4676|consensus Back     alignment and domain information
>KOG4410|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query225
1p1t_A104 Nmr Structure Of The N-Terminal Rrm Domain Of Cleav 1e-09
1fxl_A167 Crystal Structure Of Hud And Au-Rich Element Of The 2e-08
1fxl_A167 Crystal Structure Of Hud And Au-Rich Element Of The 2e-04
3pgw_S 437 Crystal Structure Of Human U1 Snrnp Length = 437 3e-08
1p27_B106 Crystal Structure Of The Human Y14MAGOH COMPLEX Len 5e-08
3cw1_K216 Crystal Structure Of Human Spliceosomal U1 Snrnp Le 6e-08
2hyi_B91 Structure Of The Human Exon Junction Complex With A 9e-08
3ex7_B126 The Crystal Structure Of Ejc In Its Transition Stat 9e-08
2xb2_D90 Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar 9e-08
2j0s_D89 The Crystal Structure Of The Exon Junction Complex 1e-07
1oo0_B110 Crystal Structure Of The Drosophila Mago Nashi-Y14 2e-07
2j0q_D109 The Crystal Structure Of The Exon Junction Complex 2e-07
1hl6_A165 A Novel Mode Of Rbd-Protein Recognition In The Y14- 2e-07
1fnx_H174 Solution Structure Of The Huc Rbd1-Rbd2 Complexed W 3e-07
1x5s_A102 Solution Structure Of Rrm Domain In A18 Hnrnp Lengt 3e-07
2dgo_A115 Solution Structure Of The Rna Binding Domain In Cyt 5e-07
2dh7_A105 Solution Structure Of The Second Rna Binding Domain 5e-07
3md3_A166 Crystal Structure Of The First Two Rrm Domains Of Y 6e-07
1d9a_A85 Solution Structure Of The Second Rna-Binding Domain 2e-06
3hi9_A84 The X-Ray Crystal Structure Of The First Rna Recogn 2e-06
2fc8_A102 Solution Structure Of The Rrm_1 Domain Of Ncl Prote 2e-06
2dgp_A106 Solution Structure Of The N-Terminal Rna Binding Do 3e-06
4ed5_A177 Crystal Structure Of The Two N-Terminal Rrm Domains 6e-06
4egl_A177 Crystal Structure Of Two Tandem Rna Recognition Mot 7e-06
4fxv_A99 Crystal Structure Of An Elav-Like Protein 1 (Elavl1 7e-06
2cpz_A115 Solution Structure Of Rna Binding Domain 3 In Cug T 1e-05
2dgq_A108 Solution Structure Of The N-Terminal Rna Binding Do 2e-05
2cjk_A167 Structure Of The Rna Binding Domain Of Hrp1 In Comp 3e-05
2khc_A118 Bruno Rrm3+ Length = 118 3e-05
1x4e_A85 Solution Structure Of Rrm Domain In Rna Binding Mot 3e-05
1x5u_A105 Solution Structure Of Rrm Domain In Splicing Factor 4e-05
2qfj_A216 Crystal Structure Of First Two Rrm Domains Of Fir B 6e-05
1x5t_A96 Solution Structure Of The Second Rrm Domain In Spli 7e-05
4f02_A213 Crystal Structure Of The Pabp-Binding Site Of Eif4g 7e-05
2yh0_A198 Solution Structure Of The Closed Conformation Of Hu 9e-05
2cqg_A103 Solution Structure Of The Rna Binding Domain Of Tar 9e-05
1cvj_A190 X-Ray Crystal Structure Of The Poly(A)-Binding Prot 1e-04
2kxf_A199 Solution Structure Of The First Two Rrm Domains Of 1e-04
1d8z_A89 Solution Structure Of The First Rna-Binding Domain 2e-04
2dh8_A105 Solution Structure Of The N-Terminal Rna Binding Do 2e-04
2jwn_A124 Solution Nmr Structure Of The Protease-Resistent Do 2e-04
1x5o_A114 Solution Structure Of Rrm Domain In Rna Binding Mot 2e-04
2dnk_A105 Solution Structure Of Rna Binding Domain In Bruno-L 2e-04
2jrs_A108 Solution Nmr Structure Of Caper Rrm2 Domain. Northe 2e-04
3uwt_A200 Crystal Structure Of A Rna Binding Domain Of Poly-U 3e-04
1u6f_A139 Nmr Solution Structure Of Tcubp1, A Single Rbd-Unit 4e-04
2dnq_A90 Solution Structure Of Rna Binding Domain 1 In Rna-B 4e-04
2dgu_A103 Solution Structure Of The Rna Binding Domain In Het 4e-04
2ki2_A90 Solution Structure Of Ss-Dna Binding Protein 12rnp2 6e-04
2cq4_A114 Solution Structure Of Rna Binding Domain In Rna Bin 7e-04
2dnz_A95 Solution Structure Of The Second Rna Binding Domain 9e-04
2km8_B84 Interdomain Rrm Packing Contributes To Rna Recognit 9e-04
>pdb|1P1T|A Chain A, Nmr Structure Of The N-Terminal Rrm Domain Of Cleavage Stimulation Factor 64 Kda Subunit Length = 104 Back     alignment and structure

Iteration: 1

Score = 60.1 bits (144), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 30/75 (40%), Positives = 45/75 (60%) Query: 91 RTLFIGRLNKNSREADLEQAFAEYGKVISVRVVRDFVTGHSKRYGFLEYDCEKACLAAIR 150 R++F+G + + E L+ F+E G V+S R+V D TG K YGF EY ++ L+A+R Sbjct: 9 RSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMR 68 Query: 151 ALNRQNFQGSEIIVD 165 LN + F G + VD Sbjct: 69 NLNGREFSGRALRVD 83
>pdb|1FXL|A Chain A, Crystal Structure Of Hud And Au-Rich Element Of The C-Fos Rna Length = 167 Back     alignment and structure
>pdb|1FXL|A Chain A, Crystal Structure Of Hud And Au-Rich Element Of The C-Fos Rna Length = 167 Back     alignment and structure
>pdb|3PGW|S Chain S, Crystal Structure Of Human U1 Snrnp Length = 437 Back     alignment and structure
>pdb|1P27|B Chain B, Crystal Structure Of The Human Y14MAGOH COMPLEX Length = 106 Back     alignment and structure
>pdb|3CW1|K Chain K, Crystal Structure Of Human Spliceosomal U1 Snrnp Length = 216 Back     alignment and structure
>pdb|2HYI|B Chain B, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 91 Back     alignment and structure
>pdb|3EX7|B Chain B, The Crystal Structure Of Ejc In Its Transition State Length = 126 Back     alignment and structure
>pdb|2XB2|D Chain D, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 90 Back     alignment and structure
>pdb|2J0S|D Chain D, The Crystal Structure Of The Exon Junction Complex At 2.2 A Resolution Length = 89 Back     alignment and structure
>pdb|1OO0|B Chain B, Crystal Structure Of The Drosophila Mago Nashi-Y14 Complex Length = 110 Back     alignment and structure
>pdb|2J0Q|D Chain D, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 109 Back     alignment and structure
>pdb|1HL6|A Chain A, A Novel Mode Of Rbd-Protein Recognition In The Y14-Mago Complex Length = 165 Back     alignment and structure
>pdb|1FNX|H Chain H, Solution Structure Of The Huc Rbd1-Rbd2 Complexed With The Au-Rich Element Length = 174 Back     alignment and structure
>pdb|1X5S|A Chain A, Solution Structure Of Rrm Domain In A18 Hnrnp Length = 102 Back     alignment and structure
>pdb|2DGO|A Chain A, Solution Structure Of The Rna Binding Domain In Cytotoxic Granule-Associated Rna Binding Protein 1 Length = 115 Back     alignment and structure
>pdb|2DH7|A Chain A, Solution Structure Of The Second Rna Binding Domain In Nucleolysin Tiar Length = 105 Back     alignment and structure
>pdb|3MD3|A Chain A, Crystal Structure Of The First Two Rrm Domains Of Yeast Poly Binding Protein (Pub1) Length = 166 Back     alignment and structure
>pdb|1D9A|A Chain A, Solution Structure Of The Second Rna-Binding Domain (Rbd2) Of Hu Antigen C (Huc) Length = 85 Back     alignment and structure
>pdb|3HI9|A Chain A, The X-Ray Crystal Structure Of The First Rna Recognition Motif (Rrm1) Of The Au-Rich Element (Are) Binding Protein Hur At 2.0 Angstrom Resolution Length = 84 Back     alignment and structure
>pdb|2FC8|A Chain A, Solution Structure Of The Rrm_1 Domain Of Ncl Protein Length = 102 Back     alignment and structure
>pdb|2DGP|A Chain A, Solution Structure Of The N-Terminal Rna Binding Domain In Bruno-Like 4 Rna-Binding Protein Length = 106 Back     alignment and structure
>pdb|4ED5|A Chain A, Crystal Structure Of The Two N-Terminal Rrm Domains Of Hur Complexed With Rna Length = 177 Back     alignment and structure
>pdb|4EGL|A Chain A, Crystal Structure Of Two Tandem Rna Recognition Motifs Of Human Antigen R Length = 177 Back     alignment and structure
>pdb|4FXV|A Chain A, Crystal Structure Of An Elav-Like Protein 1 (Elavl1) From Homo Sapiens At 1.90 A Resolution Length = 99 Back     alignment and structure
>pdb|2CPZ|A Chain A, Solution Structure Of Rna Binding Domain 3 In Cug Triplet Repeat Rna-Binding Protein 1 Length = 115 Back     alignment and structure
>pdb|2DGQ|A Chain A, Solution Structure Of The N-Terminal Rna Binding Domain In Bruno-Like 6 Rna-Binding Protein Length = 108 Back     alignment and structure
>pdb|2CJK|A Chain A, Structure Of The Rna Binding Domain Of Hrp1 In Complex With Rna Length = 167 Back     alignment and structure
>pdb|2KHC|A Chain A, Bruno Rrm3+ Length = 118 Back     alignment and structure
>pdb|1X4E|A Chain A, Solution Structure Of Rrm Domain In Rna Binding Motif, Single-Stranded Interacting Protein 2 Length = 85 Back     alignment and structure
>pdb|1X5U|A Chain A, Solution Structure Of Rrm Domain In Splicing Factor 3b Length = 105 Back     alignment and structure
>pdb|2QFJ|A Chain A, Crystal Structure Of First Two Rrm Domains Of Fir Bound To Ssdna From A Portion Of Fuse Length = 216 Back     alignment and structure
>pdb|1X5T|A Chain A, Solution Structure Of The Second Rrm Domain In Splicing Factor 3b Length = 96 Back     alignment and structure
>pdb|4F02|A Chain A, Crystal Structure Of The Pabp-Binding Site Of Eif4g In Complex With Rrm1-2 Of Pabp And Poly(A) Length = 213 Back     alignment and structure
>pdb|2YH0|A Chain A, Solution Structure Of The Closed Conformation Of Human U2af65 Tandem Rrm1 And Rrm2 Domains Length = 198 Back     alignment and structure
>pdb|2CQG|A Chain A, Solution Structure Of The Rna Binding Domain Of Tar Dna- Binding Protein-43 Length = 103 Back     alignment and structure
>pdb|1CVJ|A Chain A, X-Ray Crystal Structure Of The Poly(A)-Binding Protein In Complex With Polyadenylate Rna Length = 190 Back     alignment and structure
>pdb|2KXF|A Chain A, Solution Structure Of The First Two Rrm Domains Of Fbp-Interacting Repressor (Fir) Length = 199 Back     alignment and structure
>pdb|1D8Z|A Chain A, Solution Structure Of The First Rna-Binding Domain (Rbd1) Of Hu Antigen C (Huc) Length = 89 Back     alignment and structure
>pdb|2DH8|A Chain A, Solution Structure Of The N-Terminal Rna Binding Domain In Daz-Associated Protein 1 Length = 105 Back     alignment and structure
>pdb|2JWN|A Chain A, Solution Nmr Structure Of The Protease-Resistent Domain Of Xenopus Laevis Epabp2 Length = 124 Back     alignment and structure
>pdb|1X5O|A Chain A, Solution Structure Of Rrm Domain In Rna Binding Motif, Single-Stranded Interacting Protein 1 Length = 114 Back     alignment and structure
>pdb|2DNK|A Chain A, Solution Structure Of Rna Binding Domain In Bruno-Like 4 Rna Binding Protein Length = 105 Back     alignment and structure
>pdb|2JRS|A Chain A, Solution Nmr Structure Of Caper Rrm2 Domain. Northeast Structural Genomics Target Hr4730a Length = 108 Back     alignment and structure
>pdb|3UWT|A Chain A, Crystal Structure Of A Rna Binding Domain Of Poly-U Binding Splicing Factor 60kda (Puf60) From Homo Sapiens At 2.50 A Resolution Length = 200 Back     alignment and structure
>pdb|1U6F|A Chain A, Nmr Solution Structure Of Tcubp1, A Single Rbd-Unit From Trypanosoma Cruzi Length = 139 Back     alignment and structure
>pdb|2DNQ|A Chain A, Solution Structure Of Rna Binding Domain 1 In Rna-Binding Protein 30 Length = 90 Back     alignment and structure
>pdb|2DGU|A Chain A, Solution Structure Of The Rna Binding Domain In Heterogeneous Nuclear Ribonucleoprotein Q Length = 103 Back     alignment and structure
>pdb|2KI2|A Chain A, Solution Structure Of Ss-Dna Binding Protein 12rnp2 Precursor, Hp0827(O25501_helpy) Form Helicobacter Pylori Length = 90 Back     alignment and structure
>pdb|2CQ4|A Chain A, Solution Structure Of Rna Binding Domain In Rna Binding Motif Protein 23 Length = 114 Back     alignment and structure
>pdb|2DNZ|A Chain A, Solution Structure Of The Second Rna Binding Domain Of Rna Binding Motif Protein 23 Length = 95 Back     alignment and structure
>pdb|2KM8|B Chain B, Interdomain Rrm Packing Contributes To Rna Recognition In The Rna15, Hrp1, Anchor Rna 3' Processing Ternary Complex Length = 84 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query225
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 3e-23
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 2e-22
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 2e-22
1x4e_A85 RNA binding motif, single-stranded interacting pro 6e-22
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 8e-22
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 2e-21
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 2e-21
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 3e-21
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 4e-21
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 4e-21
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 5e-21
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 6e-21
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 8e-21
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 3e-20
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 3e-20
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 3e-20
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 4e-20
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 5e-20
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 7e-20
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 8e-20
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 9e-20
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 3e-19
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 9e-20
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 1e-19
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 2e-19
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 2e-19
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 2e-19
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 1e-16
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 2e-19
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 3e-19
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 3e-19
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 3e-19
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 3e-19
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 3e-19
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 3e-19
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 4e-19
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 3e-18
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 4e-19
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 4e-19
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 4e-19
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 7e-19
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 9e-19
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 1e-18
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 1e-18
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 1e-16
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 7e-11
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 1e-18
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 1e-18
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-18
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 3e-18
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 6e-18
1x5o_A114 RNA binding motif, single-stranded interacting pro 6e-18
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 6e-18
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 3e-17
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 7e-18
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 7e-18
3p5t_L90 Cleavage and polyadenylation specificity factor S; 7e-18
2div_A99 TRNA selenocysteine associated protein; structural 8e-18
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 8e-18
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 8e-18
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 9e-18
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 3e-15
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 1e-17
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 1e-17
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 2e-17
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 2e-17
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 2e-17
3n9u_C156 Cleavage and polyadenylation specificity factor S; 3e-17
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 4e-17
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 3e-12
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 4e-17
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 5e-17
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 4e-15
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 5e-17
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 5e-17
2cph_A107 RNA binding motif protein 19; RNA recognition moti 5e-17
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 5e-17
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 6e-17
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 6e-17
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 8e-17
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 1e-13
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 9e-17
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 9e-17
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 6e-15
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 9e-17
3q2s_C229 Cleavage and polyadenylation specificity factor S; 1e-16
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 2e-16
2i2y_A150 Fusion protein consists of immunoglobin G- binding 2e-16
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 2e-16
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 3e-16
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 3e-16
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 4e-16
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 6e-16
2dis_A109 Unnamed protein product; structural genomics, RRM 8e-16
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 2e-15
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 2e-15
2cpj_A99 Non-POU domain-containing octamer-binding protein; 3e-15
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 3e-15
2la6_A99 RNA-binding protein FUS; structural genomics, nort 6e-15
2cqd_A116 RNA-binding region containing protein 1; RNA recog 6e-15
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 8e-15
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 9e-15
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 2e-14
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-14
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 6e-14
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 6e-14
2ghp_A 292 U4/U6 snRNA-associated splicing factor PRP24; RNA 1e-13
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 1e-12
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 9e-14
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 9e-14
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 3e-12
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 1e-13
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 1e-13
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 1e-13
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 2e-13
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 2e-05
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 2e-13
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 3e-13
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 3e-13
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 4e-13
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 5e-13
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 8e-13
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 9e-13
2kt5_A124 RNA and export factor-binding protein 2; chaperone 1e-12
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 1e-12
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 1e-12
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 1e-12
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 1e-12
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 1e-12
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 3e-12
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 3e-12
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 3e-12
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 3e-12
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 5e-12
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 8e-12
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 8e-12
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 8e-12
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 8e-12
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 1e-11
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 1e-10
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 1e-11
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 2e-11
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 4e-11
2f3j_A177 RNA and export factor binding protein 2; RRM domai 4e-11
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 7e-11
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 8e-11
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 8e-11
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 1e-10
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 2e-10
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 3e-10
1x5p_A97 Negative elongation factor E; structure genomics, 3e-10
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 4e-10
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 4e-10
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 1e-09
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 5e-10
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 8e-10
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 1e-09
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 7e-09
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 3e-09
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 7e-09
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 2e-08
2dnl_A114 Cytoplasmic polyadenylation element binding protei 2e-08
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 3e-08
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 3e-08
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 5e-08
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 5e-08
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 5e-08
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 6e-08
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 8e-08
2krb_A81 Eukaryotic translation initiation factor 3 subunit 9e-08
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 1e-07
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 2e-07
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 4e-07
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 1e-06
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 2e-06
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 3e-06
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 9e-06
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 1e-05
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 3e-05
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 4e-05
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 2e-04
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 3e-04
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 8e-04
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
 Score = 90.2 bits (224), Expect = 3e-23
 Identities = 28/106 (26%), Positives = 40/106 (37%), Gaps = 5/106 (4%)

Query: 85  SSTDPTRTLFIGRLNKNSREADLEQAFAEYGKVISVRVVRDFVTGHSKRYGFLEYDCEKA 144
              D  R L +  +     E  L Q F  YG + SV++V D  T  S+ YGF+++    +
Sbjct: 37  PEPDVLRNLMVNYIPTTVDEVQLRQLFERYGPIESVKIVCDRETRQSRGYGFVKFQSGSS 96

Query: 145 CLAAIRALNRQNFQGSEIIVDFECGRVLPGWKPRRLGGGWGGNRNS 190
              AI  LN  N     + V             R    G  G+ N 
Sbjct: 97  AQQAIAGLNGFNILNKRLKVALAASG-----HQRPGIAGAVGDGNG 137


>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Length = 240 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Length = 104 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Length = 105 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query225
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.89
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.88
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.87
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.87
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.87
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.87
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.87
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.87
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.86
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.86
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.86
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.86
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.86
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.86
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.86
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.86
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.86
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.86
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.86
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.86
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.86
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.86
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.86
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.85
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.85
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.85
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.85
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.85
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.85
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.85
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.85
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.85
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.85
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.85
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.85
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.85
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.85
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.84
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.84
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.84
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.84
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.84
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.84
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.84
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.83
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.83
2div_A99 TRNA selenocysteine associated protein; structural 99.83
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.83
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.83
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.83
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.83
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.83
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.83
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.83
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.83
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.83
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.83
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.82
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.82
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.82
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.82
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.82
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.82
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.82
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.82
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.82
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.82
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.82
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.82
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.82
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.82
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.82
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.81
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.81
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.81
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.81
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.81
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.81
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.81
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.81
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.81
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.81
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.81
2dis_A109 Unnamed protein product; structural genomics, RRM 99.81
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.81
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.81
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.81
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.8
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.8
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.8
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.8
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.8
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.8
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.8
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.8
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.8
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.8
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.8
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.8
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.8
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.8
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.8
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.79
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.79
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.79
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.67
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.79
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.79
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.79
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.79
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.79
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.79
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.79
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.78
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.78
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.78
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.78
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.78
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.78
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.78
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.78
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.78
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.78
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.78
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.77
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.77
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.77
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.77
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.77
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.77
1x5p_A97 Negative elongation factor E; structure genomics, 99.76
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.76
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.76
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.76
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.76
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.76
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.76
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.76
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.76
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.76
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.76
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.75
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.75
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.74
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.74
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.74
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.74
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.74
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.74
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.74
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.73
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.73
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.73
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.73
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.73
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.73
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.72
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.72
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.72
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.72
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.71
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.71
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.71
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.7
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.7
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.7
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.7
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.7
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.7
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.69
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.69
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.69
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.69
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.68
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.67
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.67
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.66
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.65
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.65
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.65
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.65
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.64
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.62
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.62
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.62
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.62
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.61
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.6
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.59
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.58
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.58
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.58
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 99.58
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.57
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.55
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.54
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.53
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.53
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.53
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.53
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.51
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.49
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 99.46
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.37
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 99.25
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 99.24
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 99.06
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.99
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 98.53
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 97.78
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 97.71
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 97.69
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 97.53
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 97.44
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 97.14
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 96.99
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 96.47
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 96.29
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 95.94
2i2y_A150 Fusion protein consists of immunoglobin G- binding 95.52
3d45_A507 Poly(A)-specific ribonuclease PARN; CAP analogue, 92.24
2g0c_A76 ATP-dependent RNA helicase DBPA; RNA recognition m 81.37
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
Probab=99.89  E-value=6.8e-23  Score=145.26  Aligned_cols=83  Identities=31%  Similarity=0.462  Sum_probs=79.1

Q ss_pred             CCCCCeEEEcCCCCCCCHHHHHHHHhcCCceeEEEEeecCCCCccceEEEEEeCCHHHHHHHHHHhCCCccCCcEEEEEE
Q psy222           87 TDPTRTLFIGRLNKNSREADLEQAFAEYGKVISVRVVRDFVTGHSKRYGFLEYDCEKACLAAIRALNRQNFQGSEIIVDF  166 (225)
Q Consensus        87 ~~~~~~l~V~nLp~~~te~~L~~~F~~~G~v~~v~i~~~~~~g~~kg~afV~F~~~~~a~~Al~~l~g~~l~g~~l~V~~  166 (225)
                      ...+++|||+|||+++++++|+++|++||.|..|.|++++.++.++|||||+|.+.++|++||+.||+..|.|+.|+|++
T Consensus        16 ~~~gt~lfV~nLp~~~te~~L~~~F~~~G~I~~v~i~~d~~tg~~kG~afV~f~~~~~A~~Ai~~lng~~~~gr~l~V~~   95 (99)
T 4fxv_A           16 YFQGTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVNYVTAKDAERAINTLNGLRLQSKTIKVSY   95 (99)
T ss_dssp             CCCCSEEEEESCCTTCCHHHHHHHHHTTSCEEEEEEEECSSSCCEEEEEEEEESSHHHHHHHHHHHTTCEETTEECEEEE
T ss_pred             cCCCCEEEEeCCCCCCCHHHHHHHHHhcCCEEEeEeeecCCCCcccccEEEEECCHHHHHHHHHHhCCCEECCEEEEEEE
Confidence            34567999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeC
Q psy222          167 ECG  169 (225)
Q Consensus       167 a~~  169 (225)
                      |+|
T Consensus        96 AkP   98 (99)
T 4fxv_A           96 ARP   98 (99)
T ss_dssp             CCB
T ss_pred             eeC
Confidence            975



>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, exonuclease, hydrolase, magnesium, metal nonsense-mediated mRNA decay, nucleus; HET: 7MG GDP; 3.00A {Mus musculus} Back     alignment and structure
>2g0c_A ATP-dependent RNA helicase DBPA; RNA recognition motif, hydrolase; 1.70A {Bacillus subtilis} PDB: 3moj_B Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 225
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 7e-16
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 9e-15
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 1e-14
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 2e-14
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 6e-14
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 1e-13
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 1e-13
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 2e-13
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 5e-13
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 1e-12
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 1e-12
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 2e-12
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 2e-12
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 5e-12
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 6e-12
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 7e-12
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 9e-12
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 9e-12
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 1e-11
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 1e-11
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 1e-11
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-11
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 2e-11
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 2e-11
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 2e-11
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 3e-11
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 3e-11
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 5e-11
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 1e-10
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 2e-10
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 2e-10
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 2e-10
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 2e-10
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 3e-10
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 3e-10
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 3e-10
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 3e-10
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 6e-10
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 6e-10
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 1e-09
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 1e-08
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 1e-09
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 1e-09
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 2e-09
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 2e-09
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 3e-09
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 4e-09
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 5e-09
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 7e-09
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 7e-09
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 1e-08
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 3e-08
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 3e-08
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 4e-08
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 5e-08
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 1e-07
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 2e-07
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 4e-07
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 6e-07
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 7e-07
d1o0pa_104 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 8e-07
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 1e-06
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 3e-06
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 3e-06
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 3e-06
d1x4da189 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [ 6e-06
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 7e-06
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 7e-06
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 1e-05
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 2e-05
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 2e-05
d1fjeb191 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc 3e-05
d1whxa_111 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 8e-05
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 1e-04
d1wg4a_98 d.58.7.1 (A:) Splicing factor, arginine/serine-ric 5e-04
d2cq1a188 d.58.7.1 (A:51-138) Polypyrimidine tract-binding p 0.001
d1wwha181 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu 0.001
d2b0ga183 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosoph 0.004
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Poly(A)-binding protein
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 67.6 bits (165), Expect = 7e-16
 Identities = 19/75 (25%), Positives = 39/75 (52%)

Query: 92  TLFIGRLNKNSREADLEQAFAEYGKVISVRVVRDFVTGHSKRYGFLEYDCEKACLAAIRA 151
           +L++G L+ +  EA L + F+  G ++S+RV RD +T  S  Y ++ +        A+  
Sbjct: 2   SLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDT 61

Query: 152 LNRQNFQGSEIIVDF 166
           +N    +G  + + +
Sbjct: 62  MNFDVIKGKPVRIMW 76


>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Length = 83 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query225
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.89
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.89
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.88
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.88
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.88
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.88
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.88
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.88
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.88
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.88
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.87
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.87
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.87
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.87
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.86
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.86
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.86
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.86
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.86
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.86
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.86
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.86
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.86
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.86
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.85
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.85
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.85
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.85
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.85
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.85
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.84
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.84
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.84
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.84
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.84
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.83
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.83
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.83
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.83
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.83
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.83
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.82
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.82
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.82
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.81
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.81
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.8
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.8
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.8
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.8
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.8
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.79
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.79
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.79
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.79
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.79
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.79
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.79
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.79
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.79
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.79
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.79
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.79
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.78
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.78
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.78
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.78
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.78
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.77
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.75
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.75
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.75
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.74
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.74
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.72
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.7
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.69
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.69
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.66
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.66
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.6
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.56
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.55
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.55
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.5
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.48
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.41
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 97.74
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 97.65
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 97.48
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 96.41
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: RNA-binding protein UBP1
species: Trypanosoma cruzi [TaxId: 5693]
Probab=99.89  E-value=1.9e-22  Score=149.72  Aligned_cols=85  Identities=28%  Similarity=0.442  Sum_probs=80.1

Q ss_pred             CCCCeEEEcCCCCCCCHHHHHHHHhcCCceeEEEEeecCCCCccceEEEEEeCCHHHHHHHHHHhCCCccCCcEEEEEEe
Q psy222           88 DPTRTLFIGRLNKNSREADLEQAFAEYGKVISVRVVRDFVTGHSKRYGFLEYDCEKACLAAIRALNRQNFQGSEIIVDFE  167 (225)
Q Consensus        88 ~~~~~l~V~nLp~~~te~~L~~~F~~~G~v~~v~i~~~~~~g~~kg~afV~F~~~~~a~~Al~~l~g~~l~g~~l~V~~a  167 (225)
                      ...++|||+|||+++++++|+++|++||.|..|.|++++.+++++|||||+|.+.++|++||+.||+..|+|+.|+|+++
T Consensus        40 ~~~~~l~V~nLp~~~te~~l~~~F~~~G~i~~v~i~~d~~t~~~rg~afV~f~~~~~A~~Ai~~lng~~~~gr~l~V~~a  119 (139)
T d1u6fa1          40 DVLRNLMVNYIPTTVDEVQLRQLFERYGPIESVKIVCDRETRQSRGYGFVKFQSGSSAQQAIAGLNGFNILNKRLKVALA  119 (139)
T ss_dssp             TTTSEEEEESCSTTCCHHHHHHHHHHHSCEEEEEEEEETTTTEEEEEEEEEESSHHHHHHHHHHTTTEECSSCEEEEEES
T ss_pred             CCCCEEEEeCCCCCCCHHHHHHHHHhhccccccccccccccccccceeeEEECCHHHHHHHHHHhCCCEECCEEEEEEEc
Confidence            34568999999999999999999999999999999999989999999999999999999999999999999999999999


Q ss_pred             eCCCC
Q psy222          168 CGRVL  172 (225)
Q Consensus       168 ~~~~~  172 (225)
                      +++..
T Consensus       120 ~~~~~  124 (139)
T d1u6fa1         120 ASGHQ  124 (139)
T ss_dssp             SCCCC
T ss_pred             CCCCC
Confidence            87553



>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure