Diaphorina citri psyllid: psy2245


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------
MGSGLVCTNPKHNLIRHKRRYDALKDTKPPNDAEMTLQFLKSAIFYFLTDPVNAQGHLTALLSILGYSDAQKENIMKTQAHAWKYSYY
ccccccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcc
***G***TNPKHNLIRH****************EMTLQFLKSAIFYFLTDPVNAQGHLTALLSILGYSDAQKENIMKTQAHAWK****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSGLVCTNPKHNLIRHKRRYDALKDTKPPNDAEMTLQFLKSAIFYFLTDPVNAQGHLTALLSILGYSDAQKENIMKTQAHAWKYSYY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfer were detected in SWISS-PROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0048047 [BP]mating behavior, sex discriminationprobableGO:0044703, GO:0000003, GO:0007618, GO:0019098, GO:0007617, GO:0050896, GO:0007610, GO:0022414, GO:0008150, GO:0051705, GO:0051704

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Q0O, chain C
Confidence level:confident
Coverage over the Query: 13-70
View the alignment between query and template
View the model in PyMOL