Diaphorina citri psyllid: psy2248


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100--
VGPSRLSQSQQNENAEQITLLSEKINNLVSEAERVGMEGSVEKAQGLMKLCDQLKEEREMLRKQNDNNHWSQTVELAAAQEKQMEVCTVCGAFLIVGDAQSV
cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHccccHHHHHHHHHHcccccc
***********************KINNLVSEAERVGMEGSVEKAQGLMKLCD*********************VELAAAQEKQMEVCTVCGAFLIVGDA***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VGPSRLSQSQQNENAEQITLLSEKINNLVSEAERVGMEGSVEKxxxxxxxxxxxxxxxxxxxxxxxxNHWSQTVELAAAQEKQMEVCTVCGAFLIVGDAQSV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Luc7-like protein 3 Binds cAMP regulatory element DNA sequence. May play a role in RNA splicing.confidentQ3SX41
Luc7-like protein 3 Binds cAMP regulatory element DNA sequence. May play a role in RNA splicing.confidentO95232
Luc7-like protein 3 Binds cAMP regulatory element DNA sequence. May play a role in RNA splicing.confidentQ5R8W6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005925 [CC]focal adhesionprobableGO:0070161, GO:0005575, GO:0005912, GO:0005924, GO:0030054, GO:0030055
GO:0006950 [BP]response to stressprobableGO:0050896, GO:0008150
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0008380 [BP]RNA splicingprobableGO:0016070, GO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0010467, GO:0006807, GO:0008150, GO:1901360, GO:0008152, GO:0006396, GO:0046483
GO:0003729 [MF]mRNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0006915 [BP]apoptotic processprobableGO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1X0T, chain A
Confidence level:probable
Coverage over the Query: 19-61,77-100
View the alignment between query and template
View the model in PyMOL