Diaphorina citri psyllid: psy2262


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------
MLNLVIDASLSDILPVWVREKTKTLWDMHMKGPHYKKRPPRQPLLGKPFAKGVVLKVLIKKPKKPNSANRKCVLVRLSTGKEMVAYIPGEGHNLQEHNIVLCKVGRVKDLPGVKIKCVRGVYDLPHVVKKTQLTPGK
cccHHHcccccccccccHHccccHHHHHHHcccccccccccccccccccccEEEEEEEEccccccccccccEEEEEcccccEEEEEEcccccccccccEEEEEcccccccccccEEEEEcccccccccccccccccc
***LVIDASLSDILPVWVREKTKTLWDMHMK************LLGKPFAKGVVLKVLIKKPKKPNSANRKCVLVRLSTGKEMVAYIPGEGHNLQEHNIVLCKVGRVKDLPGVKIKCVRGVYDLP************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLNLVIDASLSDILPVWVREKTKTLWDMHMKGPHYKKRPPRQPLLGKPFAKGVVLKVLIKKPKKPNSANRKCVLVRLSTGKEMVAYIPGEGHNLQEHNIVLCKVGRVKDLPGVKIKCVRGVYDLPHVVKKTQLTPGK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
40S ribosomal protein S12, mitochondrial very confidentP10735
28S ribosomal protein S12, mitochondrial very confidentO35680
28S ribosomal protein S12, mitochondrial very confidentO15235

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0001666 [BP]response to hypoxiaconfidentGO:0009628, GO:0036293, GO:0050896, GO:0006950, GO:0008150, GO:0070482
GO:0005739 [CC]mitochondrionconfidentGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0007605 [BP]sensory perception of soundprobableGO:0032501, GO:0044707, GO:0050954, GO:0007600, GO:0008150, GO:0050877, GO:0044699, GO:0003008
GO:0007638 [BP]mechanosensory behaviorprobableGO:0009628, GO:0009605, GO:0044708, GO:0050896, GO:0007610, GO:0008150, GO:0009612
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0008049 [BP]male courtship behaviorprobableGO:0060179, GO:0044703, GO:0032501, GO:0032504, GO:0048609, GO:0007618, GO:0019098, GO:0007617, GO:0050896, GO:0007619, GO:0007610, GO:0022414, GO:0008150, GO:0044706, GO:0033057, GO:0000003, GO:0051705, GO:0051704
GO:0003735 [MF]structural constituent of ribosomeprobableGO:0003674, GO:0005198
GO:0006412 [BP]translationprobableGO:0071704, GO:0044267, GO:0008152, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0009058, GO:0044237, GO:0043170, GO:0044249, GO:0010467, GO:0009059, GO:0008150, GO:0034645, GO:1901576
GO:0022627 [CC]cytosolic small ribosomal subunitprobableGO:0005737, GO:0005575, GO:0005622, GO:0022626, GO:0015935, GO:0043232, GO:0005829, GO:0044464, GO:0043229, GO:0005623, GO:0044391, GO:0044446, GO:0044444, GO:0044445, GO:0044424, GO:0032991, GO:0043228, GO:0030529, GO:0043226, GO:0044422, GO:0005840
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0034337 [BP]RNA foldingprobableGO:0016070, GO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:1901360, GO:0046483
GO:0034336 [MF]misfolded RNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0040007 [BP]growthprobableGO:0008150
GO:0033120 [BP]positive regulation of RNA splicingprobableGO:0043484, GO:0045935, GO:0010604, GO:0019222, GO:0060255, GO:0031323, GO:0031325, GO:0051252, GO:0080090, GO:0051254, GO:0050794, GO:0050789, GO:0019219, GO:0065007, GO:0051171, GO:0051173, GO:0048518, GO:0008150, GO:0048522, GO:0010468, GO:0009893
GO:0000372 [BP]Group I intron splicingprobableGO:0016070, GO:0006139, GO:0044238, GO:0044260, GO:0071704, GO:0009987, GO:0006725, GO:0010467, GO:0044237, GO:0043170, GO:0090304, GO:0000375, GO:0000376, GO:0006807, GO:0008150, GO:1901360, GO:0008152, GO:0034641, GO:0008380, GO:0006396, GO:0046483
GO:0005763 [CC]mitochondrial small ribosomal subunitprobableGO:0015935, GO:0031974, GO:0043229, GO:0043228, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0005739, GO:0030529, GO:0005759, GO:0005761, GO:0000314, GO:0000313, GO:0044391, GO:0005840, GO:0032991, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044444, GO:0044429, GO:0044424, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2VQE, chain L
Confidence level:very confident
Coverage over the Query: 23-133
View the alignment between query and template
View the model in PyMOL