Diaphorina citri psyllid: psy2293


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830--
MVALGSELLSCSMSSPGGTTAIQSEPMEVDCSIMQPSEETEEKDTEPGMPCQICVCSNVDQTETFKKALASFNVPVVLVEDPDYFVHAKFDGPIIIVTSEFTNNFLRFHKPPQSRILGPTALIEMSIKVENLSIPLRTRIRPLFCHSMQNIVICITGFRNKQETMKLIDITKHMGGKLRKEMNYQVTHLIANCVSGEKYKYAMGFRVPVLTKEFVLSAWEKRYDVNFKADEPSFMNQYKLKLFQGAKVNFFGFSEEDEEQLQELLLSNGGKPSLSSDEPLTTHVVVDDSKVTCMPNVPCTSTYVVKARWFWMSIQNSECADESKYLFGKNFRTPDRAAKRKRLMEVVEEPHSSPRKSRKKRTSDIDGTPRYSCGSLLDYTTSPDNFLATDESDVMIKGNSPRHQVFKELCQTESNYVNVLRVLIEHFKNPLEEKLNTNECILNQAEMKIIFGDLCPIFDTHKDLLKDLKYLEQNYSDSVSIGEVFVKHCTAFKKVYPPFINFFQDSNSLLKEKEKNSRFLAFLKLCYMNLRDLGLPEIDKQTLPDLLIRPVQRLGSISLLLNDILKNTSKSSTDHQKLSEALDGIRTVMTFLNENKQRQDNQRSLFDIYQDIENCPPQLINSHRSFVLKCDVIELSNMLSHRGDCITLFLFTDVVEVCKKRSKYVNVLKSPNTSKMSLSTYKTQAKHPIDKTYKHIKLLSMTSIKKVYNVEDEAHDNDRQIFALRCRGSDEVIETTYSFNIIDDTLDKMSFLRELCRQASAVYCINFDKFLEDISLANASSFNIETHESSNSTLGRAIKFASKQVGRTLSLNRTPSTLRKVMSSMKVRVADT
cccccccHHHcccccccccccccccccEEcccccccccccccccccccccEEEEEECcccccHHHHHHHHHccccEEEEccHHHHHcccccccEEEEEcccccHHHHHcccccccccccHHHHHHHHHcccccccccccccccccccccccEEEEcccccHHHHHHHHHHHHHcccEEEEccccccEEEEEcccccccccccccccccEEcHHHHHHHHHccccccccccccccccccccccccccEEEEEcccHHHHHHHHHHHHHcccccccccccccccEEEEccccccccccccccccEEEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHcccccccccHHHHHcHHHHHHHHHHHHHcHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEEEEEEEEccccccccCEEEEEcccEEEEEEEccccccccccccccccccccccccccccccccccHHHccccccEEEEEEcccccccccccEEEEEccccHHcccccHHHHHHHcHHHHHHHHHHHHHHHHHHHHcccccccccccccccccCEECcccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccc
*******LLSCSMSSP*********************************PCQICVCSNVDQTETFKKALASFNVPVVLVEDPDYFVHAKFDGPIIIVTSEFTNNFLRFHKPPQSRILGPTALIEMSIKVENLSIPLRTRIRPLFCHSMQNIVICITGFRNKQETMKLIDITKHMGGKLRKEMNYQVTHLIANCVSGEKYKYAMGFRVPVLTKEFVLSAWEKRYDVNFKADEPSFMNQYKLKLFQGAKVNFFGFSEEDEEQL**************SDEPLTTHVVVDDSKVTCMPNVPCTSTYVVKARWFWMSIQNSECADESKYLFGKN*************************************************TTSPDNFLATDESDVMIKGNSPRHQVFKELCQTESNYVNVLRVLIEHFKNPLEEKLNTNECILNQAEMKIIFGDLCPIFDTHKDLLKDLKYLEQNYSDSVSIGEVFVKHCTAFKKVYPPFINFFQDSNSLLKEKEKNSRFLAFLKLCYMNLRDLGLPEIDKQTLPDLLIRPVQRLGSISLLLNDILKNTSKSSTDHQKLSEALDGIRTVMTFLNE******N**SLFDIYQDIENCPPQLINSHRSFVLKCDVIELSNMLSHRGDCITLFLFTDVVEVCKKRSKYVNVLK*************TQAKHPIDKTYKHIKLLSMTSIKKVYNVEDEAHDNDRQIFALRCRGSDEVIETTYSFNIIDDTLDKMSFLRELCRQASAVYCINFDKFLEDISLANASSFN*************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVALGSELLSCSMSSPGGTTAIQSEPMEVDCSIMQPSEETEEKDTEPGMPCQICVCSNVDQTETFKKALASFNVPVVLVEDPDYFVHAKFDGPIIIVTSEFTNNFLRFHKPPQSRILGPTALIEMSIKVENLSIPLRTRIRPLFCHSMQNIVICITGFRNKQETMKLIDITKHMGGKLRKEMNYQVTHLIANCVSGEKYKYAMGFRVPVLTKEFVLSAWEKRYDVNFKADEPSFMNQYKLKLFQGAKVNFFGFSEEDEEQLQELLLSNGGKPSLSSDEPLTTHVVVDDSKVTCMPNVPCTSTYVVKARWFWMSIQNSECADESKYLFGKNFRTPDRAAKRKRLMEVVEEPHSSPRKSRKKRTSDIDGTPRYSCGSLLDYTTSPDNFLATDESDVMIKGNSPRHQVFKELCQTESNYVNVLRVLIEHFKNPLEEKLNTNECILNQAEMKIIFGDLCPIFDTHKDLLKDLKYLEQNYSDSVSIGEVFVKHCTAFKKVYPPFINFFQDSNSLLKEKEKNSRFLAFLKLCYMNLRDLGLPEIDKQTLPDLLIRPVQRLGSISLLLNDILKNTSKSSTDHQKLSEALDGIRTVMTFLNENKQRQDNQRSLFDIYQDIENCPPQLINSHRSFVLKCDVIELSNMLSHRGDCITLFLFTDVVEVCKKRSKYVNVLKSPNTSKMSLSTYKTQAKHPIDKTYKHIKLLSMTSIKKVYNVEDEAHDNDRQIFALRCRGSDEVIETTYSFNIIDDTLDKMSFLRELCRQASAVYCINFDKFLEDISLANASSFNIETHESSNSTLGRAIKFASKQVGRTLSLNRTPSTLRKVMSSMKVRVADT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein ECT2 Guanine nucleotide exchange factor (GEF) that catalyzes the exchange of GDP for GTP. Promotes guanine nucleotide exchange on the Rho family members of small GTPases, like RHOA, RHOC, RAC1 and CDC42. Required for signal transduction pathways involved in the regulation of cytokinesis. Component of the centralspindlin complex that serves as a microtubule-dependent and Rho-mediated signaling required for the myosin contractile ring formation during the cell cycle cytokinesis. Regulates the translocation of RHOA from the central spindle to the equatorial region. Plays a role in the control of mitotic spindle assembly; regulates the activation of CDC42 in metaphase for the process of spindle fibers attachment to kinetochores before chromosome congression. Involved in the regulation of epithelial cell polarity; participates in the formation of epithelial tight junctions in a polarity complex PARD3-PARD6-protein kinase PRKCQ-dependent manner. Plays a role in the regulation of neurite outgrowth. Inhibits phenobarbital (PB)-induced NR1I3 nuclear translocation. Stimulates the activity of RAC1 through its association with the oncogenic PARD6A-PRKCI complex in cancer cells, thereby acting to coordinately drive tumor cell proliferation and invasion. Also stimulates genotoxic stress-induced RHOB activity in breast cancer cells leading to their cell death.confidentQ07139
Protein ECT2 Guanine nucleotide exchange factor (GEF) that catalyzes the exchange of GDP for GTP. Promotes guanine nucleotide exchange on the Rho family members of small GTPases, like RHOA, RHOC, RAC1 and CDC42. Required for signal transduction pathways involved in the regulation of cytokinesis. Component of the centralspindlin complex that serves as a microtubule-dependent and Rho-mediated signaling required for the myosin contractile ring formation during the cell cycle cytokinesis. Regulates the translocation of RHOA from the central spindle to the equatorial region. Plays a role in the control of mitotic spindle assembly; regulates the activation of CDC42 in metaphase for the process of spindle fibers attachment to kinetochores before chromosome congression. Involved in the regulation of epithelial cell polarity; participates in the formation of epithelial tight junctions in a polarity complex PARD3-PARD6-protein kinase PRKCQ-dependent manner. Plays a role in the regulation of neurite outgrowth. Inhibits phenobarbital (PB)-induced NR1I3 nuclear translocation. Stimulates the activity of RAC1 through its association with the oncogenic PARD6A-PRKCI complex in cancer cells, thereby acting to coordinately drive tumor cell proliferation and invasion. Also stimulates genotoxic stress-induced RHOB activity in breast cancer cells leading to their cell death.confidentQ9H8V3

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3ODW, chain A
Confidence level:very confident
Coverage over the Query: 396-671,694-764
View the alignment between query and template
View the model in PyMOL
Template: 3OLC, chain X
Confidence level:very confident
Coverage over the Query: 53-94,105-329
View the alignment between query and template
View the model in PyMOL