Diaphorina citri psyllid: psy2304


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-----
MESDIKNTPSKKKIDIMTTASNYHIEVNPNDAGIYDRVVVMELIKNVAQTNQLDPNGQRDFKGKFVARGPLVGNPWHRASSLQIA
ccccccccccccEEEEEEEEcccEEEEcccccccccHHHHHHHHHHHHHcccccccccccCEEEEEEccccccccHHHccccccc
*************IDIMTTASNYHIEVNPNDAGIYDRVVVMELIKNVAQTNQL*******FKGKFVARGPLVGNPWHR***LQ**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESDIKNTPSKKKIDIMTTASNYHIEVNPNDAGIYDRVVVMELIKNVAQTNQLDPNGQRDFKGKFVARGPLVGNPWHRASSLQIA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Replication factor C subunit 3 The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins proliferating cell nuclear antigen (PCNA) and activator 1.confidentQ8R323
Replication factor C subunit 3 The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins proliferating cell nuclear antigen (PCNA) and activator 1.confidentP40938
Replication factor C subunit 3 The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins proliferating cell nuclear antigen (PCNA) and activator 1.confidentQ2TBV1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006260 [BP]DNA replicationprobableGO:0071704, GO:1901576, GO:0044238, GO:0008152, GO:0044260, GO:0006139, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0043170, GO:0090304, GO:0044249, GO:0009058, GO:0009059, GO:0006807, GO:0034645, GO:0006259, GO:0008150, GO:1901360, GO:0046483
GO:0044427 [CC]chromosomal partprobableGO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0005694, GO:0043226, GO:0044422
GO:0016887 [MF]ATPase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0003677 [MF]DNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0006200 [BP]ATP catabolic processprobableGO:0046434, GO:0009141, GO:0009143, GO:0009144, GO:0009146, GO:0009166, GO:0009164, GO:0006807, GO:0044237, GO:0072521, GO:0072523, GO:0046130, GO:0009259, GO:1901360, GO:1901361, GO:0046700, GO:0006139, GO:1901575, GO:0006195, GO:0042278, GO:0071704, GO:0009199, GO:0006152, GO:0046483, GO:0044281, GO:0009207, GO:0009205, GO:0009987, GO:0009203, GO:0044238, GO:0046034, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0009116, GO:0008152, GO:0034655, GO:0009119, GO:0046128, GO:0009056, GO:0055086, GO:0042454, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0034641, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0006753, GO:1901658, GO:1901565
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1SXJ, chain E
Confidence level:very confident
Coverage over the Query: 17-80
View the alignment between query and template
View the model in PyMOL