Diaphorina citri psyllid: psy2348


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-
MVTPSTFKEVLVHLDLKGAPPSLTYLKEILPILAYTGATSLLIEWEDTLPYSLGFDNTNPFRETEIFIILAAAESNGLASIPLVPLYSDMDFVLKVKEFAKMRQNFNDTRFICPNARSSLDLVFKMIGRLH
cccccccccEEEEEEcccccccHHHHHHHHHHHHHccccEEEEEEcccccccccccccccccHHHHHHHHHHHHHcccEEccccccccHHHHHHcHHHHHHHHHccccccccccccHHHHHHHHHHHHccc
****STFKEVLVHLDLKGAPPSLTYLKEILPILAYTGATSLLIEWEDTLPYSLGFDNTNPFRETEIFIILAAAESNGLASIPLVPLYSDMDFVLKVKEFAKMRQNFNDTRFICPNARSSLDLVFKMIGRLH
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVTPSTFKEVLVHLDLKGAPPSLTYLKEILPILAYTGATSLLIEWEDTLPYSLGFDNTNPFRETEIFIILAAAESNGLASIPLVPLYSDMDFVLKVKEFAKMRQNFNDTRFICPNARSSLDLVFKMIGRLH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0015929 [MF]hexosaminidase activityprobableGO:0016787, GO:0003824, GO:0003674, GO:0016798, GO:0004553

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2EPL, chain X
Confidence level:very confident
Coverage over the Query: 1-131
View the alignment between query and template
View the model in PyMOL