Psyllid ID: psy2348
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 131 | ||||||
| 391326869 | 591 | PREDICTED: hexosaminidase D-like [Metase | 0.984 | 0.218 | 0.386 | 3e-20 | |
| 195569971 | 710 | GD19213 [Drosophila simulans] gi|1941989 | 0.969 | 0.178 | 0.415 | 4e-20 | |
| 195348935 | 706 | GM15285 [Drosophila sechellia] gi|194122 | 0.969 | 0.179 | 0.415 | 5e-20 | |
| 194744877 | 704 | GF18511 [Drosophila ananassae] gi|190627 | 0.969 | 0.180 | 0.415 | 7e-20 | |
| 21357133 | 708 | CG7985, isoform A [Drosophila melanogast | 0.969 | 0.179 | 0.407 | 1e-19 | |
| 347971594 | 705 | AGAP004270-PA [Anopheles gambiae str. PE | 0.916 | 0.170 | 0.382 | 2e-19 | |
| 194900276 | 706 | GG22715 [Drosophila erecta] gi|190651386 | 0.969 | 0.179 | 0.4 | 3e-19 | |
| 195497552 | 828 | GE25519 [Drosophila yakuba] gi|194182250 | 0.969 | 0.153 | 0.407 | 4e-19 | |
| 427785613 | 546 | Putative hexosaminidase d-like protein [ | 0.969 | 0.232 | 0.384 | 4e-19 | |
| 195107341 | 703 | GI23723 [Drosophila mojavensis] gi|19391 | 0.969 | 0.180 | 0.404 | 2e-18 |
| >gi|391326869|ref|XP_003737932.1| PREDICTED: hexosaminidase D-like [Metaseiulus occidentalis] | Back alignment and taxonomy information |
|---|
Score = 103 bits (256), Expect = 3e-20, Method: Compositional matrix adjust.
Identities = 51/132 (38%), Positives = 85/132 (64%), Gaps = 3/132 (2%)
Query: 2 VTPSTFKEVLVHLDLKGAPPSLTYLKEILPILAYTGATSLLIEWEDTLPYSLGFDN---T 58
+ P + ++HLDLKGAP S+TYL++I+PIL GAT LLIE+ED PY +N
Sbjct: 99 IKPVKLPQKIIHLDLKGAPLSVTYLEQIMPILQQLGATGLLIEYEDMFPYHGKLENISAI 158
Query: 59 NPFRETEIFIILAAAESNGLASIPLVPLYSDMDFVLKVKEFAKMRQNFNDTRFICPNARS 118
N + +I IL AA++N L IPL+ + ++ LK++EFA +R+ ++ + +CP+ +
Sbjct: 159 NSYSVNDIGRILEAAKANELTVIPLIQTFGHLEVALKLEEFANLREVPHNPQALCPSRNA 218
Query: 119 SLDLVFKMIGRL 130
S+ L+ +M+ ++
Sbjct: 219 SVQLITEMLKQV 230
|
Source: Metaseiulus occidentalis Species: Metaseiulus occidentalis Genus: Metaseiulus Family: Phytoseiidae Order: Mesostigmata Class: Arachnida Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|195569971|ref|XP_002102982.1| GD19213 [Drosophila simulans] gi|194198909|gb|EDX12485.1| GD19213 [Drosophila simulans] | Back alignment and taxonomy information |
|---|
| >gi|195348935|ref|XP_002041002.1| GM15285 [Drosophila sechellia] gi|194122607|gb|EDW44650.1| GM15285 [Drosophila sechellia] | Back alignment and taxonomy information |
|---|
| >gi|194744877|ref|XP_001954919.1| GF18511 [Drosophila ananassae] gi|190627956|gb|EDV43480.1| GF18511 [Drosophila ananassae] | Back alignment and taxonomy information |
|---|
| >gi|21357133|ref|NP_650689.1| CG7985, isoform A [Drosophila melanogaster] gi|442619765|ref|NP_001262699.1| CG7985, isoform B [Drosophila melanogaster] gi|5901810|gb|AAD55413.1|AF181627_1 BcDNA.GH04120 [Drosophila melanogaster] gi|10726597|gb|AAF55509.2| CG7985, isoform A [Drosophila melanogaster] gi|220943658|gb|ACL84372.1| CG7985-PA [synthetic construct] gi|440217588|gb|AGB96079.1| CG7985, isoform B [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|347971594|ref|XP_313191.5| AGAP004270-PA [Anopheles gambiae str. PEST] gi|333468737|gb|EAA08649.6| AGAP004270-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|194900276|ref|XP_001979683.1| GG22715 [Drosophila erecta] gi|190651386|gb|EDV48641.1| GG22715 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
| >gi|195497552|ref|XP_002096149.1| GE25519 [Drosophila yakuba] gi|194182250|gb|EDW95861.1| GE25519 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
| >gi|427785613|gb|JAA58258.1| Putative hexosaminidase d-like protein [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
| >gi|195107341|ref|XP_001998272.1| GI23723 [Drosophila mojavensis] gi|193914866|gb|EDW13733.1| GI23723 [Drosophila mojavensis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 131 | ||||||
| FB|FBgn0028499 | 708 | CG7985 [Drosophila melanogaste | 0.946 | 0.175 | 0.417 | 1.5e-19 | |
| WB|WBGene00013497 | 512 | hex-5 [Caenorhabditis elegans | 0.946 | 0.242 | 0.338 | 1.8e-17 | |
| WB|WBGene00015767 | 596 | hex-2 [Caenorhabditis elegans | 0.916 | 0.201 | 0.36 | 3.2e-17 | |
| MGI|MGI:3605542 | 486 | Hexdc "hexosaminidase (glycosy | 0.992 | 0.267 | 0.406 | 7.1e-17 | |
| RGD|2302323 | 486 | Hexdc "hexosaminidase (glycosy | 0.984 | 0.265 | 0.413 | 7.1e-17 | |
| WB|WBGene00021766 | 491 | hex-4 [Caenorhabditis elegans | 0.954 | 0.254 | 0.381 | 9.3e-17 | |
| UNIPROTKB|F1S009 | 481 | HEXDC "Uncharacterized protein | 0.992 | 0.270 | 0.406 | 1.1e-16 | |
| UNIPROTKB|F1MED7 | 479 | HEXDC "Hexosaminidase D" [Bos | 0.961 | 0.263 | 0.418 | 4e-16 | |
| UNIPROTKB|A6QNR0 | 346 | HEXDC "Hexosaminidase D" [Bos | 0.916 | 0.346 | 0.414 | 1.4e-15 | |
| UNIPROTKB|Q8WVB3 | 486 | HEXDC "Hexosaminidase D" [Homo | 0.961 | 0.259 | 0.427 | 1.4e-15 |
| FB|FBgn0028499 CG7985 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 243 (90.6 bits), Expect = 1.5e-19, P = 1.5e-19
Identities = 53/127 (41%), Positives = 78/127 (61%)
Query: 4 PSTFKEVLVHLDLKGAPPSLTYLKEILPILAYTGATSLLIEWEDTLPYSLGFDNT---NP 60
P E LVHLDLKGAPP L++LK++LP+L GAT LLIE+ED PYS N
Sbjct: 185 PRAPAERLVHLDLKGAPPKLSFLKQLLPVLRALGATGLLIEYEDMFPYSGVLQPLAAHNA 244
Query: 61 FRETEIFIILAAAESNGLASIPLVPLYSDMDFVLKVKEFAKMRQNFNDTRFICPNARSSL 120
++E E+ L A +GL+ +PLV + M++VLK+ F ++R+ + ICP+ S+
Sbjct: 245 YKEDELRDFLECAALHGLSVMPLVQTFGHMEYVLKLSGFEQLRELAESPQSICPSQPQSM 304
Query: 121 DLVFKMI 127
L+ +M+
Sbjct: 305 ALLEQML 311
|
|
| WB|WBGene00013497 hex-5 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00015767 hex-2 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:3605542 Hexdc "hexosaminidase (glycosyl hydrolase family 20, catalytic domain) containing" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|2302323 Hexdc "hexosaminidase (glycosyl hydrolase family 20, catalytic domain) containing" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00021766 hex-4 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S009 HEXDC "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MED7 HEXDC "Hexosaminidase D" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A6QNR0 HEXDC "Hexosaminidase D" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8WVB3 HEXDC "Hexosaminidase D" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 131 | |||
| cd06565 | 301 | cd06565, GH20_GcnA-like, Glycosyl hydrolase family | 1e-26 |
| >gnl|CDD|119335 cd06565, GH20_GcnA-like, Glycosyl hydrolase family 20 (GH20) catalytic domain of N-acetyl-beta-D-glucosaminidase (GcnA, also known as BhsA) and related proteins | Back alignment and domain information |
|---|
Score = 99 bits (250), Expect = 1e-26
Identities = 42/121 (34%), Positives = 64/121 (52%), Gaps = 4/121 (3%)
Query: 11 LVHLDLKG-APPSLTYLKEILPILAYTGATSLLIEWEDTLPYSLG---FDNTNPFRETEI 66
VHLDLK A P ++YLK++L +LA GA LL+ +EDT PY + + EI
Sbjct: 3 GVHLDLKRNAVPKVSYLKKLLRLLALLGANGLLLYYEDTFPYEGEPEVGRMRGAYTKEEI 62
Query: 67 FIILAAAESNGLASIPLVPLYSDMDFVLKVKEFAKMRQNFNDTRFICPNARSSLDLVFKM 126
I A G+ IPL+ ++F+LK EF +R+ + + +CP + D + +M
Sbjct: 63 REIDDYAAELGIEVIPLIQTLGHLEFILKHPEFRHLREVDDPPQTLCPGEPKTYDFIEEM 122
Query: 127 I 127
I
Sbjct: 123 I 123
|
GcnA is an exoglucosidase which cleaves N-acetyl-beta-D-galactosamine (NAG) and N-acetyl-beta-D-galactosamine residues from 4-methylumbelliferylated (4MU) substrates, as well as cleaving NAG from chito-oligosaccharides (i.e. NAG polymers). In contrast, sulfated forms of the substrate are unable to be cleaved and act instead as mild competitive inhibitors. Additionally, the enzyme is known to be poisoned by several first-row transition metals as well as by mercury. GcnA forms a homodimer with subunits comprised of three domains, an N-terminal zincin-like domain, this central catalytic GH20 domain, and a C-terminal alpha helical domain. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself. Length = 301 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 131 | |||
| cd06565 | 301 | GH20_GcnA-like Glycosyl hydrolase family 20 (GH20) | 100.0 | |
| cd06569 | 445 | GH20_Sm-chitobiase-like The chitobiase of Serratia | 100.0 | |
| cd06568 | 329 | GH20_SpHex_like A subgroup of the Glycosyl hydrola | 100.0 | |
| cd06570 | 311 | GH20_chitobiase-like_1 A functionally uncharacteri | 100.0 | |
| cd06563 | 357 | GH20_chitobiase-like The chitobiase of Serratia ma | 100.0 | |
| cd06564 | 326 | GH20_DspB_LnbB-like Glycosyl hydrolase family 20 ( | 100.0 | |
| cd06562 | 348 | GH20_HexA_HexB-like Beta-N-acetylhexosaminidases c | 100.0 | |
| PF00728 | 351 | Glyco_hydro_20: Glycosyl hydrolase family 20, cata | 100.0 | |
| cd02742 | 303 | GH20_hexosaminidase Beta-N-acetylhexosaminidases o | 100.0 | |
| KOG2499|consensus | 542 | 99.95 | ||
| COG3525 | 732 | Chb N-acetyl-beta-hexosaminidase [Carbohydrate tra | 99.93 | |
| PF02638 | 311 | DUF187: Glycosyl hydrolase like GH101; InterPro: I | 98.35 | |
| PF14871 | 132 | GHL6: Hypothetical glycosyl hydrolase 6 | 97.79 | |
| COG1649 | 418 | Uncharacterized protein conserved in bacteria [Fun | 97.37 | |
| PF02449 | 374 | Glyco_hydro_42: Beta-galactosidase; InterPro: IPR0 | 97.01 | |
| PF13200 | 316 | DUF4015: Putative glycosyl hydrolase domain | 96.92 | |
| PF10566 | 273 | Glyco_hydro_97: Glycoside hydrolase 97 ; InterPro: | 96.84 | |
| PF00128 | 316 | Alpha-amylase: Alpha amylase, catalytic domain; In | 96.26 | |
| PRK09441 | 479 | cytoplasmic alpha-amylase; Reviewed | 95.95 | |
| smart00642 | 166 | Aamy Alpha-amylase domain. | 95.83 | |
| PRK01060 | 281 | endonuclease IV; Provisional | 95.26 | |
| PF00150 | 281 | Cellulase: Cellulase (glycosyl hydrolase family 5) | 95.06 | |
| PRK05402 | 726 | glycogen branching enzyme; Provisional | 94.34 | |
| PRK12313 | 633 | glycogen branching enzyme; Provisional | 94.27 | |
| TIGR01515 | 613 | branching_enzym alpha-1,4-glucan:alpha-1,4-glucan | 94.22 | |
| COG0296 | 628 | GlgB 1,4-alpha-glucan branching enzyme [Carbohydra | 94.21 | |
| PLN00196 | 428 | alpha-amylase; Provisional | 94.17 | |
| PF01212 | 290 | Beta_elim_lyase: Beta-eliminating lyase; InterPro: | 94.16 | |
| TIGR02403 | 543 | trehalose_treC alpha,alpha-phosphotrehalase. Treha | 94.14 | |
| TIGR02402 | 542 | trehalose_TreZ malto-oligosyltrehalose trehalohydr | 93.87 | |
| PRK14706 | 639 | glycogen branching enzyme; Provisional | 93.8 | |
| PLN02784 | 894 | alpha-amylase | 93.64 | |
| PLN02361 | 401 | alpha-amylase | 93.41 | |
| smart00518 | 273 | AP2Ec AP endonuclease family 2. These endonuclease | 93.31 | |
| KOG0470|consensus | 757 | 93.14 | ||
| PRK09505 | 683 | malS alpha-amylase; Reviewed | 92.89 | |
| PF13199 | 559 | Glyco_hydro_66: Glycosyl hydrolase family 66; PDB: | 92.77 | |
| TIGR02100 | 688 | glgX_debranch glycogen debranching enzyme GlgX. Th | 92.59 | |
| PF07555 | 306 | NAGidase: beta-N-acetylglucosaminidase ; InterPro: | 92.27 | |
| PRK12568 | 730 | glycogen branching enzyme; Provisional | 92.15 | |
| PRK10785 | 598 | maltodextrin glucosidase; Provisional | 92.1 | |
| PLN02447 | 758 | 1,4-alpha-glucan-branching enzyme | 92.02 | |
| PRK14511 | 879 | maltooligosyl trehalose synthase; Provisional | 91.99 | |
| PRK15452 | 443 | putative protease; Provisional | 91.99 | |
| PRK14705 | 1224 | glycogen branching enzyme; Provisional | 91.85 | |
| TIGR02401 | 825 | trehalose_TreY malto-oligosyltrehalose synthase. T | 91.62 | |
| TIGR02456 | 539 | treS_nterm trehalose synthase. Trehalose synthase | 91.27 | |
| PRK10933 | 551 | trehalose-6-phosphate hydrolase; Provisional | 91.23 | |
| TIGR02104 | 605 | pulA_typeI pullulanase, type I. Pullulan is an unu | 91.2 | |
| PLN02591 | 250 | tryptophan synthase | 90.98 | |
| PF02065 | 394 | Melibiase: Melibiase; InterPro: IPR000111 O-Glycos | 90.94 | |
| PF02679 | 244 | ComA: (2R)-phospho-3-sulfolactate synthase (ComA); | 90.89 | |
| PF14488 | 166 | DUF4434: Domain of unknown function (DUF4434) | 90.87 | |
| COG1874 | 673 | LacA Beta-galactosidase [Carbohydrate transport an | 90.85 | |
| PLN02960 | 897 | alpha-amylase | 90.83 | |
| TIGR03849 | 237 | arch_ComA phosphosulfolactate synthase. This model | 90.72 | |
| PF02836 | 298 | Glyco_hydro_2_C: Glycosyl hydrolases family 2, TIM | 90.71 | |
| PRK13111 | 258 | trpA tryptophan synthase subunit alpha; Provisiona | 90.23 | |
| PRK14510 | 1221 | putative bifunctional 4-alpha-glucanotransferase/g | 89.95 | |
| TIGR00674 | 285 | dapA dihydrodipicolinate synthase. Dihydrodipicoli | 89.57 | |
| PRK03170 | 292 | dihydrodipicolinate synthase; Provisional | 88.76 | |
| KOG3698|consensus | 891 | 88.7 | ||
| PRK03705 | 658 | glycogen debranching enzyme; Provisional | 88.51 | |
| TIGR02313 | 294 | HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic ac | 88.51 | |
| PTZ00372 | 413 | endonuclease 4-like protein; Provisional | 88.46 | |
| cd01299 | 342 | Met_dep_hydrolase_A Metallo-dependent hydrolases, | 88.1 | |
| cd00950 | 284 | DHDPS Dihydrodipicolinate synthase (DHDPS) is a ke | 88.05 | |
| PRK14582 | 671 | pgaB outer membrane N-deacetylase; Provisional | 87.36 | |
| PF01301 | 319 | Glyco_hydro_35: Glycosyl hydrolases family 35; Int | 87.31 | |
| cd00408 | 281 | DHDPS-like Dihydrodipicolinate synthase family. A | 87.2 | |
| PLN02417 | 280 | dihydrodipicolinate synthase | 86.96 | |
| CHL00200 | 263 | trpA tryptophan synthase alpha subunit; Provisiona | 86.84 | |
| cd00954 | 288 | NAL N-Acetylneuraminic acid aldolase, also called | 86.66 | |
| PF14542 | 78 | Acetyltransf_CG: GCN5-related N-acetyl-transferase | 86.39 | |
| TIGR00542 | 279 | hxl6Piso_put hexulose-6-phosphate isomerase, putat | 86.31 | |
| PF05913 | 357 | DUF871: Bacterial protein of unknown function (DUF | 86.17 | |
| PRK13210 | 284 | putative L-xylulose 5-phosphate 3-epimerase; Revie | 86.12 | |
| PRK10076 | 213 | pyruvate formate lyase II activase; Provisional | 86.01 | |
| PRK14507 | 1693 | putative bifunctional 4-alpha-glucanotransferase/m | 85.38 | |
| PRK15447 | 301 | putative protease; Provisional | 84.89 | |
| PRK04147 | 293 | N-acetylneuraminate lyase; Provisional | 84.85 | |
| cd04724 | 242 | Tryptophan_synthase_alpha Ttryptophan synthase (TR | 84.57 | |
| PRK13125 | 244 | trpA tryptophan synthase subunit alpha; Provisiona | 84.33 | |
| TIGR02109 | 358 | PQQ_syn_pqqE coenzyme PQQ biosynthesis protein E. | 84.3 | |
| TIGR03234 | 254 | OH-pyruv-isom hydroxypyruvate isomerase. This enzy | 84.19 | |
| COG1313 | 335 | PflX Uncharacterized Fe-S protein PflX, homolog of | 84.08 | |
| TIGR00587 | 274 | nfo apurinic endonuclease (APN1). All proteins in | 83.99 | |
| PRK05301 | 378 | pyrroloquinoline quinone biosynthesis protein PqqE | 83.91 | |
| PF01261 | 213 | AP_endonuc_2: Xylose isomerase-like TIM barrel; In | 83.45 | |
| TIGR02102 | 1111 | pullulan_Gpos pullulanase, extracellular, Gram-pos | 83.44 | |
| TIGR00262 | 256 | trpA tryptophan synthase, alpha subunit. Tryptopha | 83.33 | |
| TIGR00683 | 290 | nanA N-acetylneuraminate lyase. N-acetylneuraminat | 82.76 | |
| PRK09856 | 275 | fructoselysine 3-epimerase; Provisional | 82.74 | |
| cd00019 | 279 | AP2Ec AP endonuclease family 2; These endonuclease | 82.52 | |
| PF00155 | 363 | Aminotran_1_2: Aminotransferase class I and II 1-a | 82.23 | |
| PF13380 | 116 | CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 | 81.93 | |
| cd00951 | 289 | KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also | 81.85 | |
| PF01055 | 441 | Glyco_hydro_31: Glycosyl hydrolases family 31 ; In | 81.73 | |
| PF03102 | 241 | NeuB: NeuB family; InterPro: IPR013132 NeuB is the | 81.33 | |
| COG0134 | 254 | TrpC Indole-3-glycerol phosphate synthase [Amino a | 81.26 | |
| PLN02877 | 970 | alpha-amylase/limit dextrinase | 81.1 | |
| PRK07998 | 283 | gatY putative fructose-1,6-bisphosphate aldolase; | 81.1 | |
| PRK13957 | 247 | indole-3-glycerol-phosphate synthase; Provisional | 81.03 | |
| TIGR01866 | 216 | cas_Csn2 CRISPR-associated protein, Csn2 family. C | 80.98 | |
| PF07905 | 123 | PucR: Purine catabolism regulatory protein-like fa | 80.62 | |
| COG0366 | 505 | AmyA Glycosidases [Carbohydrate transport and meta | 80.51 | |
| COG0826 | 347 | Collagenase and related proteases [Posttranslation | 80.28 | |
| PLN02607 | 447 | 1-aminocyclopropane-1-carboxylate synthase | 80.14 | |
| KOG4175|consensus | 268 | 80.03 |
| >cd06565 GH20_GcnA-like Glycosyl hydrolase family 20 (GH20) catalytic domain of N-acetyl-beta-D-glucosaminidase (GcnA, also known as BhsA) and related proteins | Back alignment and domain information |
|---|
Probab=100.00 E-value=5.4e-42 Score=275.60 Aligned_cols=123 Identities=34% Similarity=0.537 Sum_probs=117.9
Q ss_pred ceeEEeecCC-CCCCHHHHHHHHHHHHHcCCCEEEEEeeccCCCCCC---CCCCCCCCHHHHHHHHHHHHHcCCeEeecc
Q psy2348 9 EVLVHLDLKG-APPSLTYLKEILPILAYTGATSLLIEWEDTLPYSLG---FDNTNPFRETEIFIILAAAESNGLASIPLV 84 (131)
Q Consensus 9 ~Rg~mlD~~~-~~~~~~~lk~~i~~la~~g~n~~~l~~ed~~p~~~~---~~~~~~YT~eeikeiv~yA~~~~IevIP~i 84 (131)
.||+|||++| +++++++||++||.||.+|+|++++|+||+|||+|+ .+++++||++|||+|++||++|||+|||||
T Consensus 1 ~RG~mlD~~R~~~~~~~~lk~~id~ma~~k~N~l~lhl~D~f~~~~~p~~~~~~~~yT~~ei~ei~~yA~~~gI~vIPei 80 (301)
T cd06565 1 FRGVHLDLKRNAVPKVSYLKKLLRLLALLGANGLLLYYEDTFPYEGEPEVGRMRGAYTKEEIREIDDYAAELGIEVIPLI 80 (301)
T ss_pred CceEEEecCCCCCCCHHHHHHHHHHHHHcCCCEEEEEEecceecCCCcccccCCCCcCHHHHHHHHHHHHHcCCEEEecC
Confidence 5999999998 999999999999999999999999999999999998 455889999999999999999999999999
Q ss_pred CCcchHHHHhcccccccccccCCCCceecCCChhHHHHHHHHHhhhC
Q psy2348 85 PLYSDMDFVLKVKEFAKMRQNFNDTRFICPNARSSLDLVFKMIGRLH 131 (131)
Q Consensus 85 ~~~GH~~~~L~~p~~~~l~e~~~~~~~lcp~~~~t~~f~~~ll~ev~ 131 (131)
|||||++++|++|+|.++++++.++++|||++|+|++|+++|++|+.
T Consensus 81 d~pGH~~~~l~~~~~~~l~~~~~~~~~l~~~~~~t~~fi~~li~ev~ 127 (301)
T cd06565 81 QTLGHLEFILKHPEFRHLREVDDPPQTLCPGEPKTYDFIEEMIRQVL 127 (301)
T ss_pred CCHHHHHHHHhCcccccccccCCCCCccCCCChhHHHHHHHHHHHHH
Confidence 99999999999999999999888889999999999999999999973
|
GcnA is an exoglucosidase which cleaves N-acetyl-beta-D-galactosamine (NAG) and N-acetyl-beta-D-galactosamine residues from 4-methylumbelliferylated (4MU) substrates, as well as cleaving NAG from chito-oligosaccharides (i.e. NAG polymers). In contrast, sulfated forms of the substrate are unable to be cleaved and act instead as mild competitive inhibitors. Additionally, the enzyme is known to be poisoned by several first-row transition metals as well as by mercury. GcnA forms a homodimer with subunits comprised of three domains, an N-terminal zincin-like domain, this central catalytic GH20 domain, and a C-terminal alpha helical domain. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself. |
| >cd06569 GH20_Sm-chitobiase-like The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin | Back alignment and domain information |
|---|
| >cd06568 GH20_SpHex_like A subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the N-acetylhexosaminidase from Streptomyces plicatus (SpHex) | Back alignment and domain information |
|---|
| >cd06570 GH20_chitobiase-like_1 A functionally uncharacterized subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the chitobiase of Serratia marcescens, a beta-N-1,4-acetylhexosaminidase that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin | Back alignment and domain information |
|---|
| >cd06563 GH20_chitobiase-like The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin | Back alignment and domain information |
|---|
| >cd06564 GH20_DspB_LnbB-like Glycosyl hydrolase family 20 (GH20) catalytic domain of dispersin B (DspB), lacto-N-biosidase (LnbB) and related proteins | Back alignment and domain information |
|---|
| >cd06562 GH20_HexA_HexB-like Beta-N-acetylhexosaminidases catalyze the removal of beta-1,4-linked N-acetyl-D-hexosamine residues from the non-reducing ends of N-acetyl-beta-D-hexosaminides including N-acetylglucosides and N-acetylgalactosides | Back alignment and domain information |
|---|
| >PF00728 Glyco_hydro_20: Glycosyl hydrolase family 20, catalytic domain; InterPro: IPR015883 Glycoside hydrolase family 20 GH20 from CAZY comprises enzymes with several known activities; beta-hexosaminidase (3 | Back alignment and domain information |
|---|
| >cd02742 GH20_hexosaminidase Beta-N-acetylhexosaminidases of glycosyl hydrolase family 20 (GH20) catalyze the removal of beta-1,4-linked N-acetyl-D-hexosamine residues from the non-reducing ends of N-acetyl-beta-D-hexosaminides including N-acetylglucosides and N-acetylgalactosides | Back alignment and domain information |
|---|
| >KOG2499|consensus | Back alignment and domain information |
|---|
| >COG3525 Chb N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF02638 DUF187: Glycosyl hydrolase like GH101; InterPro: IPR003790 This entry describes proteins of unknown function | Back alignment and domain information |
|---|
| >PF14871 GHL6: Hypothetical glycosyl hydrolase 6 | Back alignment and domain information |
|---|
| >COG1649 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF02449 Glyco_hydro_42: Beta-galactosidase; InterPro: IPR013529 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PF13200 DUF4015: Putative glycosyl hydrolase domain | Back alignment and domain information |
|---|
| >PF10566 Glyco_hydro_97: Glycoside hydrolase 97 ; InterPro: IPR019563 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PF00128 Alpha-amylase: Alpha amylase, catalytic domain; InterPro: IPR006047 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PRK09441 cytoplasmic alpha-amylase; Reviewed | Back alignment and domain information |
|---|
| >smart00642 Aamy Alpha-amylase domain | Back alignment and domain information |
|---|
| >PRK01060 endonuclease IV; Provisional | Back alignment and domain information |
|---|
| >PF00150 Cellulase: Cellulase (glycosyl hydrolase family 5); InterPro: IPR001547 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PRK05402 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >PRK12313 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >TIGR01515 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase | Back alignment and domain information |
|---|
| >COG0296 GlgB 1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PLN00196 alpha-amylase; Provisional | Back alignment and domain information |
|---|
| >PF01212 Beta_elim_lyase: Beta-eliminating lyase; InterPro: IPR001597 This domain is found in many tryptophanases (tryptophan indole-lyase, TNase), tyrosine phenol-lyases (TPL) and threonine aldolases | Back alignment and domain information |
|---|
| >TIGR02403 trehalose_treC alpha,alpha-phosphotrehalase | Back alignment and domain information |
|---|
| >TIGR02402 trehalose_TreZ malto-oligosyltrehalose trehalohydrolase | Back alignment and domain information |
|---|
| >PRK14706 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >PLN02784 alpha-amylase | Back alignment and domain information |
|---|
| >PLN02361 alpha-amylase | Back alignment and domain information |
|---|
| >smart00518 AP2Ec AP endonuclease family 2 | Back alignment and domain information |
|---|
| >KOG0470|consensus | Back alignment and domain information |
|---|
| >PRK09505 malS alpha-amylase; Reviewed | Back alignment and domain information |
|---|
| >PF13199 Glyco_hydro_66: Glycosyl hydrolase family 66; PDB: 3VMO_A 3VMN_A 3VMP_A | Back alignment and domain information |
|---|
| >TIGR02100 glgX_debranch glycogen debranching enzyme GlgX | Back alignment and domain information |
|---|
| >PF07555 NAGidase: beta-N-acetylglucosaminidase ; InterPro: IPR011496 This family consists of both eukaryotic and prokaryotic hyaluronidases | Back alignment and domain information |
|---|
| >PRK12568 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >PRK10785 maltodextrin glucosidase; Provisional | Back alignment and domain information |
|---|
| >PLN02447 1,4-alpha-glucan-branching enzyme | Back alignment and domain information |
|---|
| >PRK14511 maltooligosyl trehalose synthase; Provisional | Back alignment and domain information |
|---|
| >PRK15452 putative protease; Provisional | Back alignment and domain information |
|---|
| >PRK14705 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >TIGR02401 trehalose_TreY malto-oligosyltrehalose synthase | Back alignment and domain information |
|---|
| >TIGR02456 treS_nterm trehalose synthase | Back alignment and domain information |
|---|
| >PRK10933 trehalose-6-phosphate hydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR02104 pulA_typeI pullulanase, type I | Back alignment and domain information |
|---|
| >PLN02591 tryptophan synthase | Back alignment and domain information |
|---|
| >PF02065 Melibiase: Melibiase; InterPro: IPR000111 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PF02679 ComA: (2R)-phospho-3-sulfolactate synthase (ComA); InterPro: IPR003830 Methanogenic archaea produce methane via the anaerobic reduction of acetate or single carbon compounds [] | Back alignment and domain information |
|---|
| >PF14488 DUF4434: Domain of unknown function (DUF4434) | Back alignment and domain information |
|---|
| >COG1874 LacA Beta-galactosidase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02960 alpha-amylase | Back alignment and domain information |
|---|
| >TIGR03849 arch_ComA phosphosulfolactate synthase | Back alignment and domain information |
|---|
| >PF02836 Glyco_hydro_2_C: Glycosyl hydrolases family 2, TIM barrel domain; InterPro: IPR006103 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PRK13111 trpA tryptophan synthase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PRK14510 putative bifunctional 4-alpha-glucanotransferase/glycogen debranching enzyme; Provisional | Back alignment and domain information |
|---|
| >TIGR00674 dapA dihydrodipicolinate synthase | Back alignment and domain information |
|---|
| >PRK03170 dihydrodipicolinate synthase; Provisional | Back alignment and domain information |
|---|
| >KOG3698|consensus | Back alignment and domain information |
|---|
| >PRK03705 glycogen debranching enzyme; Provisional | Back alignment and domain information |
|---|
| >TIGR02313 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase | Back alignment and domain information |
|---|
| >PTZ00372 endonuclease 4-like protein; Provisional | Back alignment and domain information |
|---|
| >cd01299 Met_dep_hydrolase_A Metallo-dependent hydrolases, subgroup A is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site | Back alignment and domain information |
|---|
| >cd00950 DHDPS Dihydrodipicolinate synthase (DHDPS) is a key enzyme in lysine biosynthesis | Back alignment and domain information |
|---|
| >PRK14582 pgaB outer membrane N-deacetylase; Provisional | Back alignment and domain information |
|---|
| >PF01301 Glyco_hydro_35: Glycosyl hydrolases family 35; InterPro: IPR001944 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >cd00408 DHDPS-like Dihydrodipicolinate synthase family | Back alignment and domain information |
|---|
| >PLN02417 dihydrodipicolinate synthase | Back alignment and domain information |
|---|
| >CHL00200 trpA tryptophan synthase alpha subunit; Provisional | Back alignment and domain information |
|---|
| >cd00954 NAL N-Acetylneuraminic acid aldolase, also called N-acetylneuraminate lyase (NAL), which catalyses the reversible aldol reaction of N-acetyl-D-mannosamine and pyruvate to give N-acetyl-D-neuraminic acid (D-sialic acid) | Back alignment and domain information |
|---|
| >PF14542 Acetyltransf_CG: GCN5-related N-acetyl-transferase; PDB: 2H5M_A 2Q44_A 1XMT_A 2Q4Y_A 2IL4_A 2EVN_A 1R57_A | Back alignment and domain information |
|---|
| >TIGR00542 hxl6Piso_put hexulose-6-phosphate isomerase, putative | Back alignment and domain information |
|---|
| >PF05913 DUF871: Bacterial protein of unknown function (DUF871); InterPro: IPR008589 This family consists of several conserved hypothetical proteins from bacteria and archaea | Back alignment and domain information |
|---|
| >PRK13210 putative L-xylulose 5-phosphate 3-epimerase; Reviewed | Back alignment and domain information |
|---|
| >PRK10076 pyruvate formate lyase II activase; Provisional | Back alignment and domain information |
|---|
| >PRK14507 putative bifunctional 4-alpha-glucanotransferase/malto-oligosyltrehalose synthase; Provisional | Back alignment and domain information |
|---|
| >PRK15447 putative protease; Provisional | Back alignment and domain information |
|---|
| >PRK04147 N-acetylneuraminate lyase; Provisional | Back alignment and domain information |
|---|
| >cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA) | Back alignment and domain information |
|---|
| >PRK13125 trpA tryptophan synthase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >TIGR02109 PQQ_syn_pqqE coenzyme PQQ biosynthesis protein E | Back alignment and domain information |
|---|
| >TIGR03234 OH-pyruv-isom hydroxypyruvate isomerase | Back alignment and domain information |
|---|
| >COG1313 PflX Uncharacterized Fe-S protein PflX, homolog of pyruvate formate lyase activating proteins [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00587 nfo apurinic endonuclease (APN1) | Back alignment and domain information |
|---|
| >PRK05301 pyrroloquinoline quinone biosynthesis protein PqqE; Provisional | Back alignment and domain information |
|---|
| >PF01261 AP_endonuc_2: Xylose isomerase-like TIM barrel; InterPro: IPR012307 This TIM alpha/beta barrel structure is found in xylose isomerase (P19148 from SWISSPROT) and in endonuclease IV (P12638 from SWISSPROT, 3 | Back alignment and domain information |
|---|
| >TIGR02102 pullulan_Gpos pullulanase, extracellular, Gram-positive | Back alignment and domain information |
|---|
| >TIGR00262 trpA tryptophan synthase, alpha subunit | Back alignment and domain information |
|---|
| >TIGR00683 nanA N-acetylneuraminate lyase | Back alignment and domain information |
|---|
| >PRK09856 fructoselysine 3-epimerase; Provisional | Back alignment and domain information |
|---|
| >cd00019 AP2Ec AP endonuclease family 2; These endonucleases play a role in DNA repair | Back alignment and domain information |
|---|
| >PF00155 Aminotran_1_2: Aminotransferase class I and II 1-aminocyclopropane-1-carboxylate synthase signature aspartate aminotransferase signature; InterPro: IPR004839 Aminotransferases share certain mechanistic features with other pyridoxal-phosphate dependent enzymes, such as the covalent binding of the pyridoxal-phosphate group to a lysine residue | Back alignment and domain information |
|---|
| >PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A | Back alignment and domain information |
|---|
| >cd00951 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also called 5-keto-4-deoxy-glucarate dehydratase (KDGDH), which is member of dihydrodipicolinate synthase (DHDPS) family that comprises several pyruvate-dependent class I aldolases | Back alignment and domain information |
|---|
| >PF01055 Glyco_hydro_31: Glycosyl hydrolases family 31 ; InterPro: IPR000322 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PF03102 NeuB: NeuB family; InterPro: IPR013132 NeuB is the prokaryotic N-acetylneuraminic acid synthase (Neu5Ac) | Back alignment and domain information |
|---|
| >COG0134 TrpC Indole-3-glycerol phosphate synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02877 alpha-amylase/limit dextrinase | Back alignment and domain information |
|---|
| >PRK07998 gatY putative fructose-1,6-bisphosphate aldolase; Reviewed | Back alignment and domain information |
|---|
| >PRK13957 indole-3-glycerol-phosphate synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR01866 cas_Csn2 CRISPR-associated protein, Csn2 family | Back alignment and domain information |
|---|
| >PF07905 PucR: Purine catabolism regulatory protein-like family; InterPro: IPR012914 This domain is found in the purine catabolism regulatory protein expressed by Bacillus subtilis (PucR, O32138 from SWISSPROT) | Back alignment and domain information |
|---|
| >COG0366 AmyA Glycosidases [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG0826 Collagenase and related proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN02607 1-aminocyclopropane-1-carboxylate synthase | Back alignment and domain information |
|---|
| >KOG4175|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 131 | |||
| 2epl_X | 627 | N-acetyl-beta-D-glucosaminidase; glycoside hydrola | 3e-11 |
| >2epl_X N-acetyl-beta-D-glucosaminidase; glycoside hydrolase, family 20, GCNA, hydro; 1.40A {Streptococcus gordonii} PDB: 2epk_X 2epm_X 2epn_A* 2epo_A Length = 627 | Back alignment and structure |
|---|
Score = 58.5 bits (141), Expect = 3e-11
Identities = 22/128 (17%), Positives = 51/128 (39%), Gaps = 11/128 (8%)
Query: 7 FKEVLVHLDL-KGAPPSLTYLKEILPILAYTGATSLLIEWEDTLPYS----LGFDNTNPF 61
++++ D + A +L+ K+++ +LA G ++ + EDT G+ +
Sbjct: 84 YEDLAYMADCSRNAVLNLSSAKKMIEVLALMGYSTFELYMEDTYEIENQPYFGYFR-GRY 142
Query: 62 RETEIFIILAAAESNGLASIPLVPLYSDMDFVLKV--KEFAKMRQNFNDTRFICPNARSS 119
E+ I A ++ +P + + + +K KE ++R + +
Sbjct: 143 TVAELQEIEDYAADFDMSFVPCIQTLAHLSAFVKWGIKEVQELRDVED---ILLIGEEKV 199
Query: 120 LDLVFKMI 127
DL+ M
Sbjct: 200 YDLIEGMF 207
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 131 | |||
| 2epl_X | 627 | N-acetyl-beta-D-glucosaminidase; glycoside hydrola | 100.0 | |
| 3gh5_A | 525 | HEX1, beta-hexosaminidase; beta-N-acetylhexosamini | 100.0 | |
| 3rcn_A | 543 | Beta-N-acetylhexosaminidase; structural genomics, | 100.0 | |
| 1now_A | 507 | Beta-hexosaminidase beta chain; (beta/alpha)8-barr | 100.0 | |
| 1jak_A | 512 | Beta-N-acetylhexosaminidase; glycoside hydrolase, | 100.0 | |
| 1yht_A | 367 | DSPB; beta barrel, hydrolase; 2.00A {Aggregatibact | 100.0 | |
| 2gjx_A | 507 | Beta-hexosaminidase alpha chain; beta-hexosaminida | 100.0 | |
| 3ozo_A | 572 | N-acetylglucosaminidase; beta-N-acetyl-D-hexosamin | 100.0 | |
| 2yl6_A | 434 | Beta-N-acetylhexosaminidase; peptidoglycan-anchor, | 100.0 | |
| 2yl5_A | 442 | Beta-N-acetylhexosaminidase; hydrolase; 2.15A {Str | 100.0 | |
| 1c7s_A | 858 | Beta-N-acetylhexosaminidase; glycosyl hydrolase, c | 100.0 | |
| 2v5c_A | 594 | O-GLCNACASE NAGJ; glycosidase, GH84, GH84C, hydrol | 99.86 | |
| 2v5d_A | 737 | O-GLCNACASE NAGJ; family 32 carbohydrate binding m | 99.84 | |
| 2cho_A | 716 | Glucosaminidase, hexosaminiase; O-GLCNACASE, hydro | 99.82 | |
| 3tty_A | 675 | Beta-GAL, beta-galactosidase; TIM barrel, glycosid | 97.35 | |
| 1kwg_A | 645 | Beta-galactosidase; TIM barrel, glycoside hydrolas | 97.21 | |
| 2d73_A | 738 | Alpha-glucosidase SUSB; glycoside hydrolase family | 96.68 | |
| 3m07_A | 618 | Putative alpha amylase; IDP00968, csgid, structura | 96.19 | |
| 2whl_A | 294 | Beta-mannanase, baman5; glycoside hydrolase, hydro | 96.05 | |
| 3pzg_A | 383 | Mannan endo-1,4-beta-mannosidase. glycosyl hydrol | 96.02 | |
| 3dhu_A | 449 | Alpha-amylase; structural genomics, hydrolase, gly | 95.85 | |
| 2xn2_A | 732 | Alpha-galactosidase; hydrolase, glycosidase; HET: | 95.76 | |
| 1rh9_A | 373 | Endo-beta-mannanase; endo-beta-mannase, retaining, | 95.74 | |
| 3nco_A | 320 | Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1 | 95.57 | |
| 3vup_A | 351 | Beta-1,4-mannanase; TIM barrel, digestive fluid, H | 95.5 | |
| 1uuq_A | 440 | Mannosyl-oligosaccharide glucosidase; hydrolase, m | 95.44 | |
| 1fob_A | 334 | Beta-1,4-galactanase; B/A barrel, glycosyl hydrola | 95.44 | |
| 3aof_A | 317 | Endoglucanase; glycosyl hydrolase family 5, cellul | 95.39 | |
| 3a24_A | 641 | Alpha-galactosidase; glycoside hydrolase family 97 | 95.36 | |
| 1ht6_A | 405 | AMY1, alpha-amylase isozyme 1; barley, beta-alpha- | 95.26 | |
| 1lwj_A | 441 | 4-alpha-glucanotransferase; alpha-amylase family, | 95.25 | |
| 2bhu_A | 602 | Maltooligosyltrehalose trehalohydrolase; alpha-amy | 95.14 | |
| 3ayr_A | 376 | Endoglucanase; TIM barrel, hydrolase, carbohydrate | 95.06 | |
| 4aie_A | 549 | Glucan 1,6-alpha-glucosidase; hydrolase, glycoside | 95.03 | |
| 2yfo_A | 720 | Alpha-galactosidase-sucrose kinase agask; hydrolas | 95.03 | |
| 1vem_A | 516 | Beta-amylase; beta-alpha-barrels, optimum PH, hydr | 94.99 | |
| 1wky_A | 464 | Endo-beta-1,4-mannanase; TIM barrel, catalytic dom | 94.99 | |
| 3icg_A | 515 | Endoglucanase D; cellulase, xylanase, carbohydrate | 94.92 | |
| 4gqr_A | 496 | Pancreatic alpha-amylase; glycosyl hydrolase, diab | 94.8 | |
| 3ndz_A | 345 | Endoglucanase D; cellotriose, xylanase, carbohydra | 94.77 | |
| 1j0h_A | 588 | Neopullulanase; beta-alpha-barrels, hydrolase; 1.9 | 94.63 | |
| 2aaa_A | 484 | Alpha-amylase; glycosidase; 2.10A {Aspergillus nig | 94.59 | |
| 3mi6_A | 745 | Alpha-galactosidase; NESG, structural genomics, PS | 94.56 | |
| 2z1k_A | 475 | (NEO)pullulanase; hydrolase, structural genomics, | 94.54 | |
| 1jae_A | 471 | Alpha-amylase; glycosidase, carbohydrate metabolis | 94.52 | |
| 2guy_A | 478 | Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; | 94.48 | |
| 1wzl_A | 585 | Alpha-amylase II; pullulan, GH-13, alpha-amylase f | 94.47 | |
| 2c0h_A | 353 | Mannan endo-1,4-beta-mannosidase; hydrolase, signa | 94.35 | |
| 3zss_A | 695 | Putative glucanohydrolase PEP1A; alpha-glucan bios | 94.31 | |
| 1ud2_A | 480 | Amylase, alpha-amylase; calcium-free, alkaline, hy | 94.17 | |
| 1ece_A | 358 | Endocellulase E1; glycosyl hydrolase; HET: BGC; 2. | 94.17 | |
| 1wpc_A | 485 | Glucan 1,4-alpha-maltohexaosidase; maltohexaose-pr | 94.16 | |
| 1gcy_A | 527 | Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-b | 94.15 | |
| 3bh4_A | 483 | Alpha-amylase; calcium, carbohydrate metabolism, g | 94.15 | |
| 1ceo_A | 343 | Cellulase CELC; glycosyl hydrolase, family A/5 of | 94.14 | |
| 3qr3_A | 340 | Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A | 94.03 | |
| 2jep_A | 395 | Xyloglucanase; family 5, plant cell WALL, hydrolas | 93.95 | |
| 1bqc_A | 302 | Protein (beta-mannanase); glycosyl hydrolase, fami | 93.88 | |
| 1vjz_A | 341 | Endoglucanase; TM1752, structural genomics, JCSG, | 93.85 | |
| 2wc7_A | 488 | Alpha amylase, catalytic region; CD/PUL-hydrolyzin | 93.81 | |
| 1ea9_C | 583 | Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A | 93.78 | |
| 1zja_A | 557 | Trehalulose synthase; sucrose isomerase, alpha-amy | 93.74 | |
| 3vgf_A | 558 | Malto-oligosyltrehalose trehalohydrolase; alpha/be | 93.67 | |
| 3aj7_A | 589 | Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydro | 93.65 | |
| 3l55_A | 353 | B-1,4-endoglucanase/cellulase; putative beta-1,4-e | 93.63 | |
| 3edf_A | 601 | FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin c | 93.56 | |
| 1h1n_A | 305 | Endo type cellulase ENGI; hydrolase, glycosyl hydr | 93.55 | |
| 1m53_A | 570 | Isomaltulose synthase; klebsiella SP. LX3, sucrose | 93.54 | |
| 4aef_A | 645 | Neopullulanase (alpha-amylase II); hydrolase, ther | 93.51 | |
| 3jug_A | 345 | Beta-mannanase; TIM-barrel, glycosidase, hydrolase | 93.48 | |
| 3civ_A | 343 | Endo-beta-1,4-mannanase; TIM barrel, hydrolase; 1. | 93.47 | |
| 1hjs_A | 332 | Beta-1,4-galactanase; 4-galactanases, family 53 gl | 93.47 | |
| 4fnq_A | 729 | Alpha-galactosidase AGAB; glycoside hydrolase, hyd | 93.46 | |
| 1hvx_A | 515 | Alpha-amylase; hydrolase, glycosyltransferase, the | 93.4 | |
| 1m7x_A | 617 | 1,4-alpha-glucan branching enzyme; alpha/beta barr | 93.33 | |
| 1qnr_A | 344 | Endo-1,4-B-D-mannanase; hydrolase, anomalous scatt | 93.25 | |
| 3faw_A | 877 | Reticulocyte binding protein; TIM barrel, beta bar | 93.22 | |
| 2ze0_A | 555 | Alpha-glucosidase; TIM barrel, glucoside hydrolase | 93.15 | |
| 1g5a_A | 628 | Amylosucrase; glycosyltransferase, glycoside hydro | 93.08 | |
| 3czg_A | 644 | Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; | 92.98 | |
| 2zic_A | 543 | Dextran glucosidase; TIM barrel, (beta/alpha)8-bar | 92.94 | |
| 1gjw_A | 637 | Maltodextrin glycosyltransferase; alpha-amylase, m | 92.91 | |
| 4aee_A | 696 | Alpha amylase, catalytic region; hydrolase, hypert | 92.9 | |
| 1uok_A | 558 | Oligo-1,6-glucosidase; sugar degradation, hydrolas | 92.86 | |
| 1wza_A | 488 | Alpha-amylase A; hydrolase, halophilic, thermophil | 92.84 | |
| 1g94_A | 448 | Alpha-amylase; beta-alpha-8-barrel, 3 domain struc | 92.8 | |
| 2dh2_A | 424 | 4F2 cell-surface antigen heavy chain; TIM-barrel, | 92.66 | |
| 1ji1_A | 637 | Alpha-amylase I; beta/alpha barrel, hydrolase; 1.6 | 92.53 | |
| 1qho_A | 686 | Alpha-amylase; glycoside hydrolase, starch degrada | 92.51 | |
| 1mxg_A | 435 | Alpha amylase; hyperthermostable, family 13 glycos | 92.46 | |
| 1ua7_A | 422 | Alpha-amylase; beta-alpha-barrels, acarbose, greek | 92.25 | |
| 1h4p_A | 408 | Glucan 1,3-beta-glucosidase I/II; hydrolase, gluca | 92.15 | |
| 3n9k_A | 399 | Glucan 1,3-beta-glucosidase; aromatic entranceway/ | 92.12 | |
| 3aml_A | 755 | OS06G0726400 protein; starch-branching, transferas | 92.05 | |
| 2wqp_A | 349 | Polysialic acid capsule biosynthesis protein SIAC; | 91.9 | |
| 3ff4_A | 122 | Uncharacterized protein; structural genomics, PSI- | 91.76 | |
| 2ya0_A | 714 | Putative alkaline amylopullulanase; hydrolase, gly | 91.74 | |
| 3bc9_A | 599 | AMYB, alpha amylase, catalytic region; acarbose, t | 91.63 | |
| 3k8k_A | 669 | Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, bet | 91.48 | |
| 2y8k_A | 491 | Arabinoxylanase, carbohydrate binding family 6; hy | 91.44 | |
| 3bmv_A | 683 | Cyclomaltodextrin glucanotransferase; glycosidase, | 91.4 | |
| 3k1d_A | 722 | 1,4-alpha-glucan-branching enzyme; mycobacterium t | 91.36 | |
| 3u7v_A | 552 | Beta-galactosidase; structural genomics, PSI-biolo | 91.32 | |
| 1d3c_A | 686 | Cyclodextrin glycosyltransferase; alpha-amylase, p | 91.23 | |
| 1bf2_A | 750 | Isoamylase; hydrolase, glycosidase, debranching en | 91.17 | |
| 3ucq_A | 655 | Amylosucrase; thermostability, amylose synthesis, | 91.09 | |
| 2vr5_A | 718 | Glycogen operon protein GLGX; hydrolase, glycosida | 91.01 | |
| 1edg_A | 380 | Endoglucanase A; family A, cellulases, xylanases, | 90.91 | |
| 1tvn_A | 293 | Cellulase, endoglucanase G; glycoside hydrolase, C | 90.53 | |
| 1cyg_A | 680 | Cyclodextrin glucanotransferase; glycosyltransfera | 90.49 | |
| 1ur4_A | 399 | Galactanase; hydrolase, beta-1, glycoside hydrolas | 90.45 | |
| 2osx_A | 481 | Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel | 90.14 | |
| 2wsk_A | 657 | Glycogen debranching enzyme; carbohydrate metaboli | 90.0 | |
| 1g01_A | 364 | Endoglucanase; alpha/beta barrel, TIM barrel, hydr | 89.92 | |
| 3aie_A | 844 | Glucosyltransferase-SI; beta-alpha-barrels; HET: M | 89.9 | |
| 3qho_A | 458 | Endoglucanase, 458AA long hypothetical endo-1,4-be | 89.87 | |
| 2xsa_A | 447 | Ogoga, hyaluronoglucosaminidase; O-GLCNACYLATION, | 89.82 | |
| 1x7f_A | 385 | Outer surface protein; structural genomics, unknow | 89.68 | |
| 2j78_A | 468 | Beta-glucosidase A; family 1, hydrolase, inhibitor | 89.65 | |
| 1vff_A | 423 | Beta-glucosidase; glycosyl hydrolase, membrane-bou | 89.63 | |
| 1egz_A | 291 | Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CL | 89.47 | |
| 7a3h_A | 303 | Endoglucanase; hydrolase, cellulose degradation, g | 89.45 | |
| 4awe_A | 387 | Endo-beta-D-1,4-mannanase; hydrolase, endo-mannana | 89.44 | |
| 1iv8_A | 720 | Maltooligosyl trehalose synthase; beta alpha barre | 89.44 | |
| 2ya1_A | 1014 | Putative alkaline amylopullulanase; hydrolase, gly | 89.25 | |
| 2p0o_A | 372 | Hypothetical protein DUF871; structural genomics, | 89.03 | |
| 1vli_A | 385 | Spore coat polysaccharide biosynthesis protein SP; | 88.92 | |
| 3pzt_A | 327 | Endoglucanase; alpha/beta barrel, glycosyl hydrola | 88.73 | |
| 1qtw_A | 285 | Endonuclease IV; DNA repair enzyme, TIM barrel, tr | 88.66 | |
| 3aam_A | 270 | Endonuclease IV, endoiv; DNA repair, base excision | 88.64 | |
| 4hz8_A | 444 | Beta-glucosidase; BGLB,BGL, hydrolase, glycosid ba | 88.18 | |
| 1qwg_A | 251 | PSL synthase;, (2R)-phospho-3-sulfolactate synthas | 88.11 | |
| 2wan_A | 921 | Pullulanase; hydrolase, glycoside hydrolase, polys | 88.1 | |
| 3d3a_A | 612 | Beta-galactosidase; protein structure initiative I | 87.87 | |
| 3ttq_A | 1108 | Dextransucrase; (beta/alpha)8 barrel, transferase; | 87.77 | |
| 2e8y_A | 718 | AMYX protein, pullulanase; multiple domain, beta-a | 87.76 | |
| 2x7v_A | 287 | Probable endonuclease 4; DNA repair protein, metal | 87.7 | |
| 4e8d_A | 595 | Glycosyl hydrolase, family 35; TIM barrel, beta-pr | 87.58 | |
| 3fj0_A | 465 | Beta-glucosidase; BGLB,BGL, hydrolase, glycosidase | 87.03 | |
| 3gnh_A | 403 | L-lysine, L-arginine carboxypeptidase CC2672; N-me | 86.74 | |
| 4aio_A | 884 | Limit dextrinase; hydrolase, pullulanase, glycosid | 86.24 | |
| 3hje_A | 704 | 704AA long hypothetical glycosyltransferase; treha | 86.14 | |
| 2w61_A | 555 | GAS2P, glycolipid-anchored surface protein 2; glyc | 85.71 | |
| 3cmg_A | 667 | Putative beta-galactosidase; structural genomics, | 85.51 | |
| 3klk_A | 1039 | Glucansucrase; native form, open conformation, mul | 85.5 | |
| 4hty_A | 359 | Cellulase; (alpha/beta)8 barrel, family 5 endogluc | 85.26 | |
| 3lpf_A | 605 | Beta-glucuronidase; alpha/beta barrel, sugar-bindi | 85.23 | |
| 3p6l_A | 262 | Sugar phosphate isomerase/epimerase; TIM barrel, s | 84.95 | |
| 2yv1_A | 294 | Succinyl-COA ligase [ADP-forming] subunit alpha; C | 84.94 | |
| 1uhv_A | 500 | Beta-xylosidase; family 39 glycoside hydrolase, xy | 84.83 | |
| 1yq2_A | 1024 | Beta-galactosidase; glycosyl hydrolase family 2, T | 84.56 | |
| 3og2_A | 1003 | Beta-galactosidase; TIM barrel domain, glycoside h | 84.45 | |
| 2yv2_A | 297 | Succinyl-COA synthetase alpha chain; COA-binding d | 84.3 | |
| 1oi7_A | 288 | Succinyl-COA synthetase alpha chain; SCS, ligase, | 83.64 | |
| 3c8f_A | 245 | Pyruvate formate-lyase 1-activating enzyme; adoMet | 83.64 | |
| 3aal_A | 303 | Probable endonuclease 4; endoiv, DNA repair, base | 83.6 | |
| 1tg7_A | 971 | Beta-galactosidase; TIM barrel domain, glycoside h | 83.18 | |
| 3ahx_A | 453 | Beta-glucosidase A; cellulases, glycosyl hydrolase | 83.15 | |
| 1zy9_A | 564 | Alpha-galactosidase; TM1192, struc genomics, joint | 83.11 | |
| 3lmz_A | 257 | Putative sugar isomerase; structural genomics, joi | 82.74 | |
| 2qw5_A | 335 | Xylose isomerase-like TIM barrel; putative sugar p | 82.57 | |
| 3tsm_A | 272 | IGPS, indole-3-glycerol phosphate synthase; struct | 82.4 | |
| 1vs1_A | 276 | 3-deoxy-7-phosphoheptulonate synthase; (beta/alpha | 82.38 | |
| 3kws_A | 287 | Putative sugar isomerase; structural genomics, joi | 82.37 | |
| 3f5l_A | 481 | Beta-glucosidase; beta-alpha-barrels, glycosidase, | 82.32 | |
| 3ta9_A | 458 | Glycoside hydrolase family 1; TIM barrel, glucosid | 82.21 | |
| 1w91_A | 503 | Beta-xylosidase; MAD, seMet, tetramer, hydrolase; | 81.99 | |
| 3s5u_A | 220 | Putative uncharacterized protein; crispr, crispr a | 81.87 | |
| 3thd_A | 654 | Beta-galactosidase; TIM-barrel domain, glycosyl hy | 81.66 | |
| 1qox_A | 449 | Beta-glucosidase; hydrolase, cellulose degradation | 81.64 | |
| 2j6v_A | 301 | UV endonuclease, UVDE; plasmid, TIM barrel, DNA re | 81.39 | |
| 1zco_A | 262 | 2-dehydro-3-deoxyphosphoheptonate aldolase; arabin | 81.07 | |
| 2o9p_A | 454 | Beta-glucosidase B; family 1 glycoside hydrolase; | 81.03 | |
| 3can_A | 182 | Pyruvate-formate lyase-activating enzyme; structur | 80.44 | |
| 3gnp_A | 488 | OS03G0212800 protein; beta-alpha barrel, glycosida | 80.38 | |
| 3tcm_A | 500 | Alanine aminotransferase 2; pyridoxal phosphate (P | 80.37 | |
| 3feq_A | 423 | Putative amidohydrolase; unknown source, sargasso | 80.26 |
| >2epl_X N-acetyl-beta-D-glucosaminidase; glycoside hydrolase, family 20, GCNA, hydro; 1.40A {Streptococcus gordonii} PDB: 2epk_X 2epm_X 2epn_A* 2epo_A | Back alignment and structure |
|---|
Probab=100.00 E-value=2.4e-39 Score=280.18 Aligned_cols=128 Identities=16% Similarity=0.192 Sum_probs=118.5
Q ss_pred CCCCCCCCceeEEeecCCC-CCCHHHHHHHHHHHHHcCCCEEEEEeeccCCCCCC---CCCCCCCCHHHHHHHHHHHHHc
Q psy2348 1 MVTPSTFKEVLVHLDLKGA-PPSLTYLKEILPILAYTGATSLLIEWEDTLPYSLG---FDNTNPFRETEIFIILAAAESN 76 (131)
Q Consensus 1 ~~D~P~f~~Rg~mlD~~~~-~~~~~~lk~~i~~la~~g~n~~~l~~ed~~p~~~~---~~~~~~YT~eeikeiv~yA~~~ 76 (131)
++|+|+|++||+|||++|| |+++++||++||.||.+|+|++.+|++|+|+++++ ...+++||++|+|+|++||++|
T Consensus 78 I~D~P~f~~RG~mlD~sR~~f~~~~~ik~~id~ma~~KlN~lh~Hl~D~~ei~~~P~l~~~~~~YT~~di~eiv~yA~~r 157 (627)
T 2epl_X 78 IEEEAAYEDLAYMADCSRNAVLNLSSAKKMIEVLALMGYSTFELYMEDTYEIENQPYFGYFRGRYTVAELQEIEDYAADF 157 (627)
T ss_dssp EEECCSCSEEEEEEECSSSCCBCHHHHHHHHHHHHHHTCCEEEEECSSCBCCTTCTTTTTTTTCBCHHHHHHHHHHHHHT
T ss_pred EEeCCCCCccceEEecCCCCCCCHHHHHHHHHHHHHcCCcEEEEEeecccccCCCcccCccCCCcCHHHHHHHHHHHHHc
Confidence 4799999999999999999 99999999999999999999999999999877665 3356899999999999999999
Q ss_pred CCeEeeccCCcchHHHHhcc--cccccccccCCCCceecCCChhHHHHHHHHHhhhC
Q psy2348 77 GLASIPLVPLYSDMDFVLKV--KEFAKMRQNFNDTRFICPNARSSLDLVFKMIGRLH 131 (131)
Q Consensus 77 ~IevIP~i~~~GH~~~~L~~--p~~~~l~e~~~~~~~lcp~~~~t~~f~~~ll~ev~ 131 (131)
||+||||||||||+.+++++ +.|++|++. +++|||++|+|++|+++|++||+
T Consensus 158 gI~VIPEID~PGH~~a~l~~g~~~yp~L~~~---~~~l~~~~~~t~~fl~~v~~Ev~ 211 (627)
T 2epl_X 158 DMSFVPCIQTLAHLSAFVKWGIKEVQELRDV---EDILLIGEEKVYDLIEGMFQTMA 211 (627)
T ss_dssp TCEEEEECCSSSCCHHHHTCCSHHHHTTEEE---TTEECTTCHHHHHHHHHHHHHHT
T ss_pred CCEEEEeeccCCcHHHHHhhhhhhcccccCC---CCccCCCChhHHHHHHHHHHHHH
Confidence 99999999999999999998 678888773 47999999999999999999984
|
| >3gh5_A HEX1, beta-hexosaminidase; beta-N-acetylhexosaminidase, glycosphingolipids, paenibacill GH20, hydrolase, structural genomics, NPPSFA; HET: NAG; 1.60A {Paenibacillus SP} PDB: 3gh4_A* 3gh7_A* 3sur_A* 3sus_A* 3sut_A* 3suu_A* 3suv_A* 3suw_A* | Back alignment and structure |
|---|
| >3rcn_A Beta-N-acetylhexosaminidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta half sandwich; HET: MSE; 2.51A {Arthrobacter aurescens} | Back alignment and structure |
|---|
| >1now_A Beta-hexosaminidase beta chain; (beta/alpha)8-barrel, homodimer, family 20 glycosidase, HYDR; HET: NAG IFG; 2.20A {Homo sapiens} SCOP: c.1.8.6 d.92.2.1 PDB: 1nou_A* 1np0_A* 2gjx_B* 3lmy_A* 1o7a_A* 2gk1_B* | Back alignment and structure |
|---|
| >1jak_A Beta-N-acetylhexosaminidase; glycoside hydrolase, family 20, substrate-assisted catalysis, alpha/beta barrel, isofagomin inhibitor complex; HET: IFG; 1.75A {Streptomyces plicatus} SCOP: c.1.8.6 d.92.2.1 PDB: 1hp4_A* 1hp5_A* 1m01_A* 1m04_A* 1m03_A* | Back alignment and structure |
|---|
| >1yht_A DSPB; beta barrel, hydrolase; 2.00A {Aggregatibacter actinomycetemcomitans} SCOP: c.1.8.6 | Back alignment and structure |
|---|
| >2gjx_A Beta-hexosaminidase alpha chain; beta-hexosaminidase A, glycosidase, TAY-sachs disease, GM2 ganglisode, TIM barrel, hydrolase; HET: NAG BMA NDG; 2.80A {Homo sapiens} SCOP: c.1.8.6 d.92.2.1 PDB: 2gk1_A* | Back alignment and structure |
|---|
| >3ozo_A N-acetylglucosaminidase; beta-N-acetyl-D-hexosaminidase, hydrolase-hydrolase inhibito; HET: NGT; 2.00A {Ostrinia furnacalis} PDB: 3nsn_A* 3nsm_A* 3ozp_A* 3s6t_A* 3vtr_A* | Back alignment and structure |
|---|
| >2yl6_A Beta-N-acetylhexosaminidase; peptidoglycan-anchor, hydrolase; HET: ETE; 1.60A {Streptococcus pneumoniae} PDB: 2yll_A* 2yl8_A* 3rpm_A* | Back alignment and structure |
|---|
| >2yl5_A Beta-N-acetylhexosaminidase; hydrolase; 2.15A {Streptococcus pneumoniae} PDB: 2yla_A* 2yl9_A* | Back alignment and structure |
|---|
| >1c7s_A Beta-N-acetylhexosaminidase; glycosyl hydrolase, chitinolysis, A/B(TIM)-barrel, site directed mutagenesis; HET: CBS; 1.80A {Serratia marcescens} SCOP: b.1.18.2 b.2.2.3 c.1.8.6 d.92.2.1 PDB: 1c7t_A* 1qba_A 1qbb_A* | Back alignment and structure |
|---|
| >2v5c_A O-GLCNACASE NAGJ; glycosidase, GH84, GH84C, hydrolase, coiled coil, family 84 glycoside hydrolase, carbohydrate binding module; 2.10A {Clostridium perfringens} PDB: 2cbj_A* 2cbi_A 2vur_A* 2x0y_A* 2j62_A* 2wb5_A* 2xpk_A* 2yds_A* 2ydr_A* 2ydq_A* | Back alignment and structure |
|---|
| >2v5d_A O-GLCNACASE NAGJ; family 32 carbohydrate binding module, glycosidase, GH84, GH84C, CBM32, hydrolase, coiled coil; 3.30A {Clostridium perfringens} | Back alignment and structure |
|---|
| >2cho_A Glucosaminidase, hexosaminiase; O-GLCNACASE, hydrolase, N-acetylglucosamine; 1.85A {Bacteroides thetaiotaomicron} SCOP: a.246.1.1 c.1.8.10 d.92.2.3 PDB: 2chn_A 2vvn_A* 2vvs_A* 2x0h_A* 2xm2_A* 2w4x_A* 2w66_A* 2w67_A* 2wca_A* 2xj7_A* 2xm1_A* 2j47_A* 2jiw_A* 2wzh_A* 2wzi_A* 2j4g_A* | Back alignment and structure |
|---|
| >3tty_A Beta-GAL, beta-galactosidase; TIM barrel, glycoside hydrolase, hydrolase; HET: GLA; 2.25A {Bacillus circulans subsp} PDB: 3tts_A* | Back alignment and structure |
|---|
| >1kwg_A Beta-galactosidase; TIM barrel, glycoside hydrolase family 42, trimer, hydrolase; 1.60A {Thermus thermophilus} SCOP: b.71.1.1 c.1.8.1 c.23.16.5 PDB: 1kwk_A* | Back alignment and structure |
|---|
| >2d73_A Alpha-glucosidase SUSB; glycoside hydrolase family 97, TIM barrel; 1.60A {Bacteroides thetaiotaomicron vpi-5482} PDB: 2zq0_A* 2jke_A* 2jka_A* 2jkp_A* | Back alignment and structure |
|---|
| >3m07_A Putative alpha amylase; IDP00968, csgid, structural genomics, center for structural genomics of infectious diseases, unknown function; HET: BTB PG4 PGE; 1.40A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >2whl_A Beta-mannanase, baman5; glycoside hydrolase, hydrolase; HET: MAN BMA; 1.40A {Bacillus agaradhaerens} PDB: 2whj_A | Back alignment and structure |
|---|
| >3pzg_A Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 5; alpha/beta barrel, glycosyl hydrolase, sugar binding, secret hydrolase; 1.40A {Thermotoga petrophila} PDB: 3pz9_A 3pzi_A* 3pzm_A 3pzn_A* 3pzo_A* 3pzq_A* | Back alignment and structure |
|---|
| >3dhu_A Alpha-amylase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >2xn2_A Alpha-galactosidase; hydrolase, glycosidase; HET: SME GLA IMD; 1.58A {Lactobacillus acidophilus ncfm} PDB: 2xn1_A* 2xn0_A* | Back alignment and structure |
|---|
| >1rh9_A Endo-beta-mannanase; endo-beta-mannase, retaining, glycoside hydrolase family 5; 1.50A {Solanum lycopersicum} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >3nco_A Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1, hydrolase; 1.50A {Fervidobacterium nodosum} PDB: 3rjx_A 3rjy_A* | Back alignment and structure |
|---|
| >3vup_A Beta-1,4-mannanase; TIM barrel, digestive fluid, HYD; 1.05A {Aplysia kurodai} | Back alignment and structure |
|---|
| >1uuq_A Mannosyl-oligosaccharide glucosidase; hydrolase, mannosidase, mannan, glycoside hydrolase, family 5; 1.5A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uz4_A* | Back alignment and structure |
|---|
| >1fob_A Beta-1,4-galactanase; B/A barrel, glycosyl hydrolase, family 53, CLAN GH-A; 1.80A {Aspergillus aculeatus} SCOP: c.1.8.3 PDB: 1fhl_A | Back alignment and structure |
|---|
| >3aof_A Endoglucanase; glycosyl hydrolase family 5, cellulase, biofuel, hyperthermo hydrolase; HET: BMA; 1.29A {Thermotoga maritima} PDB: 3amg_A* 3amc_A 3amd_A 3mmu_A 3mmw_A 3azs_A* 3azr_A* 3azt_A* | Back alignment and structure |
|---|
| >3a24_A Alpha-galactosidase; glycoside hydrolase family 97, retaining glycosidase; HET: MES; 2.30A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1ht6_A AMY1, alpha-amylase isozyme 1; barley, beta-alpha-barrel, hydrolase; 1.50A {Hordeum vulgare} SCOP: b.71.1.1 c.1.8.1 PDB: 1p6w_A* 1rpk_A* 3bsg_A 2qpu_A* 1rp8_A* 1rp9_A* 2qps_A 3bsh_A* 1ava_A 1amy_A 1bg9_A* | Back alignment and structure |
|---|
| >1lwj_A 4-alpha-glucanotransferase; alpha-amylase family, acarbose, (beta/alpha)8 barrel; HET: ACG; 2.50A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1lwh_A* | Back alignment and structure |
|---|
| >2bhu_A Maltooligosyltrehalose trehalohydrolase; alpha-amylase, protein-carbohydrate complex, desiccation resistance; HET: TRS PGE; 1.1A {Deinococcus radiodurans} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 2bhy_A* 2bhz_A* 2bxy_A* 2bxz_A* 2by0_A* 2by1_A* 2by2_A* 2by3_A* | Back alignment and structure |
|---|
| >3ayr_A Endoglucanase; TIM barrel, hydrolase, carbohydrate/sugar binding; 2.00A {Piromyces rhizinflatus} PDB: 3ays_A* | Back alignment and structure |
|---|
| >4aie_A Glucan 1,6-alpha-glucosidase; hydrolase, glycoside hydrolase 13; HET: MES GOL; 2.05A {Lactobacillus acidophilus ncfm} | Back alignment and structure |
|---|
| >2yfo_A Alpha-galactosidase-sucrose kinase agask; hydrolase; HET: GLA GAL; 1.35A {Ruminococcus gnavus E1} PDB: 2yfn_A* | Back alignment and structure |
|---|
| >1vem_A Beta-amylase; beta-alpha-barrels, optimum PH, hydrolase; HET: GLC; 1.85A {Bacillus cereus} SCOP: b.3.1.1 c.1.8.1 PDB: 1b90_A* 1j0y_A* 1j0z_A* 1j10_A* 1b9z_A* 1j12_A* 1j18_A* 1j11_A* 5bca_A 1veo_A* 1itc_A* 1ven_A* 1vep_A* 1cqy_A | Back alignment and structure |
|---|
| >1wky_A Endo-beta-1,4-mannanase; TIM barrel, catalytic domain, CBM, hydrolase; 1.65A {Bacillus SP} SCOP: b.18.1.31 c.1.8.3 | Back alignment and structure |
|---|
| >4gqr_A Pancreatic alpha-amylase; glycosyl hydrolase, diabetes, obesity, digestion, glycosidas inhibition, flavonol, drug design; HET: NAG MYC; 1.20A {Homo sapiens} PDB: 1cpu_A* 1bsi_A 1u2y_A* 1u30_A* 1u33_A* 1xcw_A* 1xcx_A* 1xd0_A* 1xd1_A* 2qmk_A* 2qv4_A* 3bai_A* 3baj_A* 3baw_A* 3ij7_A* 1hny_A* 3ij9_A* 3ij8_A* 4gqq_A* 1kgw_A* ... | Back alignment and structure |
|---|
| >3ndz_A Endoglucanase D; cellotriose, xylanase, carbohydrate binding D glucanase, hydrolase; HET: CT3; 2.08A {Clostridium cellulovorans} PDB: 3ndy_A* | Back alignment and structure |
|---|
| >1j0h_A Neopullulanase; beta-alpha-barrels, hydrolase; 1.90A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1j0i_A* 1j0j_A* 1j0k_A* 1sma_A 1gvi_A* | Back alignment and structure |
|---|
| >2aaa_A Alpha-amylase; glycosidase; 2.10A {Aspergillus niger} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >3mi6_A Alpha-galactosidase; NESG, structural genomics, PSI-2, protein structure initiati northeast structural genomics consortium, hydrolase; 2.70A {Lactobacillus brevis} | Back alignment and structure |
|---|
| >2z1k_A (NEO)pullulanase; hydrolase, structural genomics, NPPSFA, national project on structural and functional analyses; HET: GLC; 2.30A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1jae_A Alpha-amylase; glycosidase, carbohydrate metabolism, 4-glucan-4-glucanohydrolase, hydrolase; 1.65A {Tenebrio molitor} SCOP: b.71.1.1 c.1.8.1 PDB: 1clv_A 1tmq_A 1viw_A* | Back alignment and structure |
|---|
| >2guy_A Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; HET: NAG BMA; 1.59A {Aspergillus oryzae} SCOP: b.71.1.1 c.1.8.1 PDB: 2gvy_A* 3kwx_A* 6taa_A 7taa_A* 2taa_A | Back alignment and structure |
|---|
| >1wzl_A Alpha-amylase II; pullulan, GH-13, alpha-amylase family, hydrolase; 2.00A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1ji2_A 1bvz_A 1vfk_A* 3a6o_A* 1wzm_A 1jf6_A 1wzk_A 2d2o_A* 1jib_A* 1jl8_A* 1vb9_A* 1g1y_A* 1vfo_A* 1vfm_A* 1vfu_A* 1jf5_A | Back alignment and structure |
|---|
| >2c0h_A Mannan endo-1,4-beta-mannosidase; hydrolase, signal, TIM alpha/beta barrel; 1.6A {Mytilus edulis} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >3zss_A Putative glucanohydrolase PEP1A; alpha-glucan biosynthesis, glycoside hydrolase FA; 1.80A {Streptomyces coelicolor} PDB: 3zst_A* 3zt5_A* 3zt6_A* 3zt7_A* | Back alignment and structure |
|---|
| >1ud2_A Amylase, alpha-amylase; calcium-free, alkaline, hydrolase; 2.13A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1ud4_A 1ud5_A 1ud6_A 1ud8_A 1ud3_A | Back alignment and structure |
|---|
| >1ece_A Endocellulase E1; glycosyl hydrolase; HET: BGC; 2.40A {Acidothermus cellulolyticus} SCOP: c.1.8.3 PDB: 1vrx_A | Back alignment and structure |
|---|
| >1wpc_A Glucan 1,4-alpha-maltohexaosidase; maltohexaose-producing amylase, alpha-amylase, acarbose, HYD; HET: ACI GLC GAL; 1.90A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1wp6_A* 2d3l_A* 2d3n_A* 2die_A 2gjp_A* 2gjr_A 1w9x_A* | Back alignment and structure |
|---|
| >1gcy_A Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-barrel, beta sheet; 1.60A {Pseudomonas stutzeri} SCOP: b.71.1.1 c.1.8.1 PDB: 1jdc_A* 1jda_A* 1jdd_A* 1qi5_A* 1qi3_A* 1qi4_A* 2amg_A 1qpk_A* | Back alignment and structure |
|---|
| >3bh4_A Alpha-amylase; calcium, carbohydrate metabolism, glycosidase, hydrolase, metal-binding, secreted; 1.40A {Bacillus amyloliquefaciens} PDB: 1e43_A 1e3z_A* 1e40_A* 1e3x_A 1vjs_A 1ob0_A 1bli_A 1bpl_B 1bpl_A | Back alignment and structure |
|---|
| >1ceo_A Cellulase CELC; glycosyl hydrolase, family A/5 of glycosyl hydrolases, cellulose degradation; 1.90A {Clostridium thermocellum} SCOP: c.1.8.3 PDB: 1cen_A 1cec_A | Back alignment and structure |
|---|
| >3qr3_A Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A {Hypocrea jecorina} | Back alignment and structure |
|---|
| >2jep_A Xyloglucanase; family 5, plant cell WALL, hydrolase; 1.4A {Paenibacillus pabuli} PDB: 2jeq_A* | Back alignment and structure |
|---|
| >1bqc_A Protein (beta-mannanase); glycosyl hydrolase, family 5, thermomonospora fusca; 1.50A {Thermobifida fusca} SCOP: c.1.8.3 PDB: 2man_A* 3man_A* | Back alignment and structure |
|---|
| >1vjz_A Endoglucanase; TM1752, structural genomics, JCSG, PSI, prote structure initiative, joint center for structural genomics; 2.05A {Thermotoga maritima} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >2wc7_A Alpha amylase, catalytic region; CD/PUL-hydrolyzing enzymes, hydrolase, glycosidase, neopullu; 2.37A {Nostoc punctiforme} PDB: 2wcs_A 2wkg_A | Back alignment and structure |
|---|
| >1ea9_C Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A {Bacillus SP} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >1zja_A Trehalulose synthase; sucrose isomerase, alpha-amylase family, (beta/alpha)8 barrel; 1.60A {Pseudomonas mesoacidophila} PDB: 1zjb_A 2pwd_A* 2pwh_A 2pwg_A 2pwe_A* 2pwf_A* 3gbe_A* 3gbd_A* | Back alignment and structure |
|---|
| >3vgf_A Malto-oligosyltrehalose trehalohydrolase; alpha/beta barrel, alpha-amylas hydrolase; HET: GLC FLC; 2.30A {Sulfolobus solfataricus} PDB: 3vge_A* 3vgd_A* 3vgb_A* 1eh9_A* 3vgh_A* 3vgg_A* 1eha_A | Back alignment and structure |
|---|
| >3aj7_A Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydrolase; 1.30A {Saccharomyces cerevisiae} PDB: 3a4a_A* 3a47_A 3axi_A* 3axh_A* | Back alignment and structure |
|---|
| >3edf_A FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin complex, glycosidase, hydrolase; HET: CE6 ACX; 1.65A {Flavobacterium SP} PDB: 3edj_A* 3edk_A* 3ede_A 3edd_A* 1h3g_A | Back alignment and structure |
|---|
| >1h1n_A Endo type cellulase ENGI; hydrolase, glycosyl hydrolase, family 5, subtype, thermophilic, thermophIle, endoglucanase; 1.12A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1gzj_A | Back alignment and structure |
|---|
| >1m53_A Isomaltulose synthase; klebsiella SP. LX3, sucrose isomerization, isomerase; 2.20A {Klebsiella SP} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >4aef_A Neopullulanase (alpha-amylase II); hydrolase, thermostability, high temperature; 2.34A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3jug_A Beta-mannanase; TIM-barrel, glycosidase, hydrolase; 1.60A {Bacillus} | Back alignment and structure |
|---|
| >3civ_A Endo-beta-1,4-mannanase; TIM barrel, hydrolase; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >1hjs_A Beta-1,4-galactanase; 4-galactanases, family 53 glycoside hydrolase, thermostability, PH optimum, CLAN GH-A, thermophIle, alkalophIle; HET: NAG EPE; 1.87A {Thielavia heterothallica} SCOP: c.1.8.3 PDB: 1hju_A* 1hjq_A* | Back alignment and structure |
|---|
| >4fnq_A Alpha-galactosidase AGAB; glycoside hydrolase, hydrolase; 1.80A {Geobacillus stearothermophilus} PDB: 4fnr_A 4fnu_A* 4fnt_A* 4fns_A* 4fnp_A* | Back alignment and structure |
|---|
| >1hvx_A Alpha-amylase; hydrolase, glycosyltransferase, thermostability; 2.00A {Geobacillus stearothermophilus} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >1m7x_A 1,4-alpha-glucan branching enzyme; alpha/beta barrel, beta sandwich, transferase; 2.30A {Escherichia coli} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 3o7y_A* 3o7z_A* | Back alignment and structure |
|---|
| >1qnr_A Endo-1,4-B-D-mannanase; hydrolase, anomalous scattering; HET: NAG MAB; 1.4A {Trichoderma reesei} SCOP: c.1.8.3 PDB: 1qno_A* 1qnq_A* 1qnp_A* 1qns_A* | Back alignment and structure |
|---|
| >3faw_A Reticulocyte binding protein; TIM barrel, beta barrel, hydrolase, cell WALL, peptidoglycan-anchor, secreted; 2.10A {Streptococcus agalactiae COH1} PDB: 3fax_A* | Back alignment and structure |
|---|
| >2ze0_A Alpha-glucosidase; TIM barrel, glucoside hydrolase, extremophIle, hydrolase; 2.00A {Geobacillus SP} | Back alignment and structure |
|---|
| >1g5a_A Amylosucrase; glycosyltransferase, glycoside hydrolase, (beta-alpha)8 barrel; HET: EPE; 1.40A {Neisseria polysaccharea} SCOP: b.71.1.1 c.1.8.1 PDB: 1jg9_A* 1mw1_A* 1mw2_A* 1mw3_A* 3ueq_A* 1jgi_A* 1mvy_A* 1mw0_A* 1s46_A* 1zs2_A* | Back alignment and structure |
|---|
| >3czg_A Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 1.80A {Xanthomonas axonopodis PV} PDB: 3cze_A* 3czl_A* 3czk_A* 2wpg_A | Back alignment and structure |
|---|
| >2zic_A Dextran glucosidase; TIM barrel, (beta/alpha)8-barrel, hydrolase; 2.20A {Streptococcus mutans} PDB: 2zid_A* | Back alignment and structure |
|---|
| >1gjw_A Maltodextrin glycosyltransferase; alpha-amylase, maltosyltransferase; HET: MAL GLC; 2.1A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1gju_A* | Back alignment and structure |
|---|
| >4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} | Back alignment and structure |
|---|
| >1uok_A Oligo-1,6-glucosidase; sugar degradation, hydrolase, TIM-barrel glycosidase; 2.00A {Bacillus cereus} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >1wza_A Alpha-amylase A; hydrolase, halophilic, thermophilic; 1.60A {Halothermothrix orenii} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >1g94_A Alpha-amylase; beta-alpha-8-barrel, 3 domain structure, hydrolase; HET: DAF GLC; 1.74A {Pseudoalteromonas haloplanktis} SCOP: b.71.1.1 c.1.8.1 PDB: 1g9h_A* 1l0p_A 1aqm_A* 1aqh_A* 1b0i_A 1jd7_A 1jd9_A 1kxh_A* | Back alignment and structure |
|---|
| >2dh2_A 4F2 cell-surface antigen heavy chain; TIM-barrel, glycosidase like, antiparallel beta-sheet, greek terminal domain, extracellular domain; 2.10A {Homo sapiens} PDB: 2dh3_A | Back alignment and structure |
|---|
| >1ji1_A Alpha-amylase I; beta/alpha barrel, hydrolase; 1.60A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1uh3_A* 2d0f_A* 1izj_A 1uh4_A* 1uh2_A* 2d0g_A* 2d0h_A* 1izk_A | Back alignment and structure |
|---|
| >1qho_A Alpha-amylase; glycoside hydrolase, starch degradation; HET: MAL ABD; 1.70A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1qhp_A* | Back alignment and structure |
|---|
| >1mxg_A Alpha amylase; hyperthermostable, family 13 glycosyl hydrola (beta/alpha)8-barrel, hydrolase; HET: ACR ETE; 1.60A {Pyrococcus woesei} SCOP: b.71.1.1 c.1.8.1 PDB: 1mwo_A* 1mxd_A* 3qgv_A* | Back alignment and structure |
|---|
| >1ua7_A Alpha-amylase; beta-alpha-barrels, acarbose, greek-KEY motif, hydrolase; HET: ACI GLD GLC G6D BGC; 2.21A {Bacillus subtilis} SCOP: b.71.1.1 c.1.8.1 PDB: 1bag_A* 3dc0_A | Back alignment and structure |
|---|
| >1h4p_A Glucan 1,3-beta-glucosidase I/II; hydrolase, glucan degradation, hydrolyase, glycosidase; HET: NAG BMA MAN NDG; 1.75A {Saccharomyces cerevisiae} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >3n9k_A Glucan 1,3-beta-glucosidase; aromatic entranceway/clamp, exoglucanase, glycoside hydrolas protein-carbohydrate interaction; HET: BGC; 1.70A {Candida albicans} SCOP: c.1.8.3 PDB: 2pc8_A* 2pb1_A* 2pbo_A 3o6a_A 2pf0_A 1cz1_A 1eqc_A* 1eqp_A | Back alignment and structure |
|---|
| >3aml_A OS06G0726400 protein; starch-branching, transferase; HET: EPE; 1.70A {Oryza sativa japonica group} PDB: 3amk_A | Back alignment and structure |
|---|
| >2wqp_A Polysialic acid capsule biosynthesis protein SIAC; NEUB, inhibitor, TIM barrel, sialic acid synthase, transfera; HET: WQP; 1.75A {Neisseria meningitidis} PDB: 2zdr_A 1xuz_A* 1xuu_A 3cm4_A | Back alignment and structure |
|---|
| >3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >2ya0_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; 1.85A {Streptococcus pneumoniae} PDB: 2ya2_A* | Back alignment and structure |
|---|
| >3bc9_A AMYB, alpha amylase, catalytic region; acarbose, thermostable, halophilic, N domain, starch binding, hydrolase; HET: G6D GLC ACI BGC ACR; 1.35A {Halothermothrix orenii} PDB: 3bcd_A* 3bcf_A | Back alignment and structure |
|---|
| >3k8k_A Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, beta-sandwich, membrane protein; 2.20A {Bacteroides thetaiotaomicron} PDB: 3k8m_A* 3k8l_A* | Back alignment and structure |
|---|
| >2y8k_A Arabinoxylanase, carbohydrate binding family 6; hydrolase; 1.47A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >3bmv_A Cyclomaltodextrin glucanotransferase; glycosidase, thermostable, family 13 glycosyl hydrolas; 1.60A {Thermoanaerobacterium thermosulfurigenorganism_taxid} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 3bmw_A* 1ciu_A 1a47_A 1pj9_A* 1cgt_A | Back alignment and structure |
|---|
| >3k1d_A 1,4-alpha-glucan-branching enzyme; mycobacterium tuberculosis H37RV, mesophilic human pathogen, RV1326C gene, glycosyl transferase; 2.33A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3u7v_A Beta-galactosidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, TIM barrel, glyco_hydro_42; HET: MSE; 1.80A {Caulobacter crescentus} | Back alignment and structure |
|---|
| >1d3c_A Cyclodextrin glycosyltransferase; alpha-amylase, product complex, oligosaccharide, family 13 glycosyl hydrolase, transglycosylation; HET: GLC; 1.78A {Bacillus circulans} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1cxf_A* 1cxk_A* 1cdg_A* 1cxe_A* 1cxh_A* 1cxi_A* 2cxg_A* 1cgv_A* 2dij_A* 1cgy_A* 1kck_A* 1cgx_A* 1cxl_A* 1cgw_A* 1tcm_A 1kcl_A* 1eo5_A* 1eo7_A* 1dtu_A* 1ot1_A* ... | Back alignment and structure |
|---|
| >1bf2_A Isoamylase; hydrolase, glycosidase, debranching enzyme; 2.00A {Pseudomonas amyloderamosa} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >3ucq_A Amylosucrase; thermostability, amylose synthesis, sucrose isomerization, beta/alpha-barrel, carbohydrate binding, transferase; 1.97A {Deinococcus geothermalis} PDB: 3uer_A* | Back alignment and structure |
|---|
| >2vr5_A Glycogen operon protein GLGX; hydrolase, glycosidase, glycosyl hydrolase, glycogen debraching; HET: GLC A16; 2.8A {Sulfolobus solfataricus} PDB: 2vnc_A* 2vuy_A | Back alignment and structure |
|---|
| >1edg_A Endoglucanase A; family A, cellulases, xylanases, family 5 of glycosyl hydrol cellulose degradation; 1.60A {Clostridium cellulolyticum} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >1tvn_A Cellulase, endoglucanase G; glycoside hydrolase, CLAN GH-A, family 5-2; 1.41A {Pseudoalteromonas haloplanktis} SCOP: c.1.8.3 PDB: 1tvp_A* | Back alignment and structure |
|---|
| >1cyg_A Cyclodextrin glucanotransferase; glycosyltransferase; 2.50A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >1ur4_A Galactanase; hydrolase, beta-1, glycoside hydrolase, substrate specificity, pectin, GH-A, family 53, plant cell WALL degradation; HET: B2G PGE; 2.2A {Bacillus licheniformis} SCOP: c.1.8.3 PDB: 1r8l_A* 1ur0_A* 2ccr_A* 2j74_A* 2gft_A* | Back alignment and structure |
|---|
| >2osx_A Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel, hydrolase; HET: SIA GAL BGC 16C; 1.10A {Rhodococcus SP} PDB: 2oyk_A* 2osw_A* 2oyl_A* 2oym_A* 2osy_A* | Back alignment and structure |
|---|
| >2wsk_A Glycogen debranching enzyme; carbohydrate metabolism, hydrolase, glycosidase, ISO-amylase glycosyl hydrolase, glycogen metabolism; 2.25A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >1g01_A Endoglucanase; alpha/beta barrel, TIM barrel, hydrolase; 1.90A {Bacillus SP} SCOP: c.1.8.3 PDB: 1g0c_A* | Back alignment and structure |
|---|
| >3aie_A Glucosyltransferase-SI; beta-alpha-barrels; HET: MES; 2.10A {Streptococcus mutans} PDB: 3aic_A* 3aib_A* | Back alignment and structure |
|---|
| >3qho_A Endoglucanase, 458AA long hypothetical endo-1,4-beta-glucanase; cellulase, catalytic domain, hydrolase; HET: CTT; 1.65A {Pyrococcus horikoshii} PDB: 3axx_A* 2zum_A 2zun_A* 3qhm_A* 3qhn_A* | Back alignment and structure |
|---|
| >2xsa_A Ogoga, hyaluronoglucosaminidase; O-GLCNACYLATION, O-GLCNACASE, glycosyl hydrolase, hydrolase; 2.00A {Oceanicola granulosus} PDB: 2xsb_A* | Back alignment and structure |
|---|
| >1x7f_A Outer surface protein; structural genomics, unknown function, MCSG, PSI, midwest center for struct genomics; 2.30A {Bacillus cereus atcc 14579} SCOP: b.62.1.2 c.1.8.12 | Back alignment and structure |
|---|
| >2j78_A Beta-glucosidase A; family 1, hydrolase, inhibitor, glycosidase, polysaccharide degradation, transition state mimic, carbohydrate metabolism; HET: GOX; 1.65A {Thermotoga maritima} SCOP: c.1.8.4 PDB: 1oif_A* 1oim_A* 1oin_A* 1od0_A* 1w3j_A* 1uz1_A* 2cbv_A* 2ces_A* 2cet_A* 2j75_A* 2j77_A* 2cbu_A* 2j79_A* 2j7b_A* 2j7c_A* 2j7d_A* 2j7e_A* 2j7f_A* 2j7g_A* 2j7h_A* ... | Back alignment and structure |
|---|
| >1vff_A Beta-glucosidase; glycosyl hydrolase, membrane-bound enzyme, thermostability, TIM barrel, alkylglucosides; 2.50A {Pyrococcus horikoshii} SCOP: c.1.8.4 | Back alignment and structure |
|---|
| >1egz_A Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CLAN GH-A, family 5-2, cellulase; 2.30A {Erwinia chrysanthemi} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >7a3h_A Endoglucanase; hydrolase, cellulose degradation, glycoside H family 5, michaelis complex, SKEW-BOAT, distortion; 0.95A {Bacillus agaradhaerens} SCOP: c.1.8.3 PDB: 1h2j_A* 1hf6_A* 1ocq_A* 1w3k_A* 1h11_A* 4a3h_A* 5a3h_A* 6a3h_A* 1w3l_A 8a3h_A* 2v38_A* 1qhz_A 1qi0_A* 1e5j_A* 1qi2_A* 1h5v_A* 1a3h_A 2a3h_A* 3a3h_A* 1lf1_A | Back alignment and structure |
|---|
| >4awe_A Endo-beta-D-1,4-mannanase; hydrolase, endo-mannanase, glycosyl hydrolase, GH5; HET: NAG; 1.40A {Neurospora sitophila} | Back alignment and structure |
|---|
| >1iv8_A Maltooligosyl trehalose synthase; beta alpha barrel, intramolecular transglucosylation, isomerase; HET: MLZ MLY; 1.90A {Sulfolobus acidocaldarius} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >2ya1_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; HET: BGC GLC; 2.25A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2p0o_A Hypothetical protein DUF871; structural genomics, TIM barrel, PF05 2, protein structure initiative, midwest center for structu genomics; 2.15A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >1vli_A Spore coat polysaccharide biosynthesis protein SP; 2636322, JCSG, protein structure initiative, BS SPSE, PSI; 2.38A {Bacillus subtilis} SCOP: b.85.1.1 c.1.10.6 | Back alignment and structure |
|---|
| >3pzt_A Endoglucanase; alpha/beta barrel, glycosyl hydrolase, cellulose binding, HY; 1.97A {Bacillus subtilis subsp} PDB: 3pzu_A 3pzv_A | Back alignment and structure |
|---|
| >1qtw_A Endonuclease IV; DNA repair enzyme, TIM barrel, trinuclear Zn cluster, hydrolase; 1.02A {Escherichia coli} SCOP: c.1.15.1 PDB: 1qum_A* 2nqh_A 2nqj_A* 2nq9_A* | Back alignment and structure |
|---|
| >3aam_A Endonuclease IV, endoiv; DNA repair, base excision repair, BER, TIM barrel, endonucle hydrolase, structural genomics, NPPSFA; 1.58A {Thermus thermophilus} | Back alignment and structure |
|---|
| >4hz8_A Beta-glucosidase; BGLB,BGL, hydrolase, glycosid barrel, carbohydrate/sugar binding; HET: BGC; 1.14A {Uncultured bacterium} PDB: 4hz7_A* 4hz6_A* 3fj0_A* 3cmj_A 3fiz_A* 3fiy_A* | Back alignment and structure |
|---|
| >1qwg_A PSL synthase;, (2R)-phospho-3-sulfolactate synthase; beta-alpha-barrel, lyase; 1.60A {Methanocaldococcus jannaschii} SCOP: c.1.27.1 | Back alignment and structure |
|---|
| >2wan_A Pullulanase; hydrolase, glycoside hydrolase, polysaccharide, amylase, starch, carbohydrate; 1.65A {Bacillus acidopullulyticus} | Back alignment and structure |
|---|
| >3d3a_A Beta-galactosidase; protein structure initiative II, PSI II, NYSGXRC, 11092F, structural genomics; 2.15A {Bacteroides thetaiotaomicron vpi-5482} | Back alignment and structure |
|---|
| >3ttq_A Dextransucrase; (beta/alpha)8 barrel, transferase; HET: PG4; 1.90A {Leuconostoc mesenteroides} PDB: 3tto_A* | Back alignment and structure |
|---|
| >2e8y_A AMYX protein, pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, HY; 2.11A {Bacillus subtilis} PDB: 2e8z_A* 2e9b_A* | Back alignment and structure |
|---|
| >2x7v_A Probable endonuclease 4; DNA repair protein, metal-binding, hydrolase, DNA damage, DN; 2.30A {Thermotoga maritima MSB8} PDB: 2x7w_A* | Back alignment and structure |
|---|
| >4e8d_A Glycosyl hydrolase, family 35; TIM barrel, beta-propeller, glycohydrolase; 1.80A {Streptococcus pneumoniae} PDB: 4e8c_A | Back alignment and structure |
|---|
| >4aio_A Limit dextrinase; hydrolase, pullulanase, glycoside hydrolase family 13; 1.90A {Hordeum vulgare} PDB: 2x4c_A* 2y4s_A* 2y5e_A* 2x4b_A | Back alignment and structure |
|---|
| >3hje_A 704AA long hypothetical glycosyltransferase; trehalose biosynthesis, maltooligoside trehalose synthase (M family 13 glycoside hydrolases; 1.90A {Sulfolobus tokodaii str} | Back alignment and structure |
|---|
| >2w61_A GAS2P, glycolipid-anchored surface protein 2; glycoprotein, cell membrane, fungal cell WALL, transglycosyl glucan, membrane, GPI-anchor; 1.62A {Saccharomyces cerevisiae} PDB: 2w62_A* 2w63_A* | Back alignment and structure |
|---|
| >3cmg_A Putative beta-galactosidase; structural genomics, PSI-2, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3klk_A Glucansucrase; native form, open conformation, multidomain protein, glycosyltransferase, transferase; 1.65A {Lactobacillus reuteri} PDB: 3kll_A* 3hz3_A* 4amc_A | Back alignment and structure |
|---|
| >4hty_A Cellulase; (alpha/beta)8 barrel, family 5 endoglucanase, hydrolase; 2.00A {Uncultured bacterium} PDB: 4hu0_A* | Back alignment and structure |
|---|
| >3lpf_A Beta-glucuronidase; alpha/beta barrel, sugar-binding domain, beta-sandwich domai glycosyl hydrolase, glycosida hydrolase; HET: Z77; 2.26A {Escherichia coli} PDB: 3k46_A* 3k4d_A* 3lpg_A* 3k4a_A | Back alignment and structure |
|---|
| >3p6l_A Sugar phosphate isomerase/epimerase; TIM barrel, structural genomics, joint center for structural genomics, JCSG; HET: CIT; 1.85A {Parabacteroides distasonis} | Back alignment and structure |
|---|
| >2yv1_A Succinyl-COA ligase [ADP-forming] subunit alpha; COA-binding domain, structural genomics, NPPSFA; 1.70A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1uhv_A Beta-xylosidase; family 39 glycoside hydrolase, xylan, xylose, covalent glycosyl-enzyme intermediate; 2.10A {Thermoanaerobacterium saccharolyticum} SCOP: b.71.1.2 c.1.8.3 PDB: 1px8_A | Back alignment and structure |
|---|
| >1yq2_A Beta-galactosidase; glycosyl hydrolase family 2, TIM barrel, hexamer; 1.90A {Arthrobacter SP} SCOP: b.1.4.1 b.1.4.1 b.18.1.5 b.30.5.1 c.1.8.3 | Back alignment and structure |
|---|
| >3og2_A Beta-galactosidase; TIM barrel domain, glycoside hydrolase, family 35, glycoprot hydrolase; HET: NAG BMA MAN GLC; 1.20A {Trichoderma reesei} PDB: 3ogr_A* 3ogs_A* 3ogv_A* | Back alignment and structure |
|---|
| >2yv2_A Succinyl-COA synthetase alpha chain; COA-binding domain, ligase, structural genomics, NPPSFA; 2.20A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 | Back alignment and structure |
|---|
| >3c8f_A Pyruvate formate-lyase 1-activating enzyme; adoMet radical, SAM radical, activase, glycyl radical, 4Fe- 4S, carbohydrate metabolism, cytoplasm; HET: MT2 PGE; 2.25A {Escherichia coli} PDB: 3cb8_A* | Back alignment and structure |
|---|
| >3aal_A Probable endonuclease 4; endoiv, DNA repair, base excision repair, TIM barrel, DNA DA endonuclease, hydrolase, metal-binding; 1.60A {Geobacillus kaustophilus} PDB: 1xp3_A | Back alignment and structure |
|---|
| >1tg7_A Beta-galactosidase; TIM barrel domain, glycoside hydrolase, family GH35, glycopr penicillium, hydrolase; HET: NAG BMA MAN; 1.90A {Penicillium SP} SCOP: b.149.1.1 b.18.1.27 b.18.1.27 b.71.1.5 c.1.8.14 PDB: 1xc6_A* | Back alignment and structure |
|---|
| >3ahx_A Beta-glucosidase A; cellulases, glycosyl hydrolase, manganese enhancement, hydro; HET: 7PE; 1.90A {Clostridium cellulovorans} | Back alignment and structure |
|---|
| >1zy9_A Alpha-galactosidase; TM1192, struc genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI, hydrolase; 2.34A {Thermotoga maritima} SCOP: b.30.5.11 c.1.8.13 | Back alignment and structure |
|---|
| >3lmz_A Putative sugar isomerase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS isomerase; HET: MSE CIT PGE; 1.44A {Parabacteroides distasonis} | Back alignment and structure |
|---|
| >2qw5_A Xylose isomerase-like TIM barrel; putative sugar phosphate isomerase/epimerase; 1.78A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 | Back alignment and structure |
|---|
| >1vs1_A 3-deoxy-7-phosphoheptulonate synthase; (beta/alpha)8 barrel, transferase; HET: PEP; 2.30A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3kws_A Putative sugar isomerase; structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 1.68A {Parabacteroides distasonis atcc 8503} | Back alignment and structure |
|---|
| >3f5l_A Beta-glucosidase; beta-alpha-barrels, glycosidase, hydrolase; HET: LB2 MES; 1.37A {Oryza sativa japonica group} PDB: 3aht_A* 3ahv_A* 3f5i_A* 3f5j_A* 3f5k_A* 3f4v_A* 2rgm_A* 2rgl_A* 3scr_A* 3scs_A* 3scp_A* 3scq_A* 3scu_A* 3scn_A* 3sco_A* 3sct_A* 3scv_A* 3scw_A* | Back alignment and structure |
|---|
| >3ta9_A Glycoside hydrolase family 1; TIM barrel, glucosidase; 3.00A {Halothermothrix orenii} | Back alignment and structure |
|---|
| >1w91_A Beta-xylosidase; MAD, seMet, tetramer, hydrolase; 2.2A {Geobacillus stearothermophilus} SCOP: b.71.1.2 c.1.8.3 PDB: 2bs9_A 2bfg_A* | Back alignment and structure |
|---|
| >3s5u_A Putative uncharacterized protein; crispr, crispr adaptation mechanism, NEW spacer aquisition, binding, DNA binding protein; 2.70A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3thd_A Beta-galactosidase; TIM-barrel domain, glycosyl hydrolase, glycosylation, hydrolase; HET: NAG DGJ; 1.79A {Homo sapiens} PDB: 3thc_A* | Back alignment and structure |
|---|
| >1qox_A Beta-glucosidase; hydrolase, cellulose degradation; 2.7A {Bacillus circulans} SCOP: c.1.8.4 | Back alignment and structure |
|---|
| >2j6v_A UV endonuclease, UVDE; plasmid, TIM barrel, DNA repair, DNA binding protein, lyase; HET: KCX ALY; 1.55A {Thermus thermophilus} PDB: 3bzg_A 3c0s_A* 3c0l_A 3c0q_A* 3bzj_A | Back alignment and structure |
|---|
| >1zco_A 2-dehydro-3-deoxyphosphoheptonate aldolase; arabino-heptulosonate, synthase, shikimate, DAHP, DAH7P, DAH DAH7PS, lyase; HET: PEP; 2.25A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2o9p_A Beta-glucosidase B; family 1 glycoside hydrolase; 2.10A {Paenibacillus polymyxa} PDB: 2o9t_A* 2z1s_A* 2jie_A* 2o9r_A* | Back alignment and structure |
|---|
| >3can_A Pyruvate-formate lyase-activating enzyme; structural genomics, pyruvate-formate lyase-activating enzym MCSG, APC20359.1; 1.80A {Bacteroides vulgatus atcc 8482} | Back alignment and structure |
|---|
| >3gnp_A OS03G0212800 protein; beta-alpha barrel, glycosidase, hydrolase; HET: SOG; 1.80A {Oryza sativa subsp} PDB: 3gno_A* 3gnr_A* | Back alignment and structure |
|---|
| >3tcm_A Alanine aminotransferase 2; pyridoxal phosphate (PLP)-binding; HET: DCS; 2.71A {Hordeum vulgare} | Back alignment and structure |
|---|
| >3feq_A Putative amidohydrolase; unknown source, sargasso SEA, structural GEN protein structure initiative, PSI; 2.63A {Unidentified} PDB: 3lwy_A* 3n2c_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 131 | |||
| d1jaka1 | 356 | beta-N-acetylhexosaminidase {Streptomyces plicatus | 100.0 | |
| d1nowa1 | 353 | beta-hexosaminidase B {Human (Homo sapiens) [TaxId | 100.0 | |
| d1qbaa3 | 443 | Bacterial chitobiase (beta-N-acetylhexosaminidase) | 100.0 | |
| d2gjxa1 | 362 | beta-hexosaminidase A {Human (Homo sapiens) [TaxId | 100.0 | |
| d1yhta1 | 344 | Dispersin B, DspB {Actinobacillus actinomycetemcom | 100.0 | |
| d1rh9a1 | 370 | Beta-mannanase {Tomato (Lycopersicon esculentum) [ | 97.26 | |
| d1kwga2 | 393 | A4 beta-galactosidase {Thermus thermophilus [TaxId | 96.79 | |
| d1wkya2 | 297 | Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 2449 | 96.74 | |
| d2bhua3 | 420 | Glycosyltrehalose trehalohydrolase, central domain | 96.63 | |
| d1uuqa_ | 410 | Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} | 96.57 | |
| d1eh9a3 | 400 | Glycosyltrehalose trehalohydrolase, central domain | 96.56 | |
| d1m7xa3 | 396 | 1,4-alpha-glucan branching enzyme, central domain | 96.52 | |
| d1ud2a2 | 390 | Bacterial alpha-amylase {Bacillus sp., ksm-k38 [Ta | 96.38 | |
| d1gcya2 | 357 | G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase | 96.31 | |
| d1bf2a3 | 475 | Isoamylase, central domain {Pseudomonas amyloderam | 96.22 | |
| d2c0ha1 | 350 | endo-1,4-beta-mannosidase {Blue mussel (Mytilus ed | 96.16 | |
| d2aaaa2 | 381 | Fungal alpha-amylases {Aspergillus niger, acid amy | 96.07 | |
| d1lwha2 | 391 | 4-alpha-glucanotransferase {Thermotoga maritima [T | 96.04 | |
| d1j0ha3 | 382 | Neopullulanase, central domain {Bacillus stearothe | 96.0 | |
| d2d3na2 | 394 | Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: | 95.99 | |
| d1ht6a2 | 347 | Plant alpha-amylase {Barley (Hordeum vulgare), AMY | 95.9 | |
| d1hjsa_ | 332 | Beta-1,4-galactanase {Thielavia heterothallica, ak | 95.8 | |
| d1qnra_ | 344 | Beta-mannanase {Trichoderma reesei [TaxId: 51453]} | 95.78 | |
| d1ea9c3 | 382 | Maltogenic amylase, central domain {Bacillus sp., | 95.56 | |
| d2guya2 | 381 | Fungal alpha-amylases {Aspergillus oryzae, Taka-am | 95.55 | |
| d1edga_ | 380 | Endoglucanase CelA {Clostridium cellulolyticum [Ta | 95.51 | |
| d1vjza_ | 325 | Endoglucanase homologue TM1752 {Thermotoga maritim | 95.51 | |
| d3bmva4 | 406 | Cyclodextrin glycosyltransferase {Thermoanaerobact | 95.42 | |
| d1hvxa2 | 393 | Bacterial alpha-amylase {Bacillus stearothermophil | 95.42 | |
| d1ur4a_ | 387 | Beta-1,4-galactanase {Bacillus licheniformis [TaxI | 95.21 | |
| d1mxga2 | 361 | Bacterial alpha-amylase {Archaeon Pyrococcus woese | 95.17 | |
| d1wzla3 | 382 | Maltogenic amylase, central domain {Thermoactinomy | 95.16 | |
| d1h3ga3 | 422 | Cyclomaltodextrinase, central domain {Flavobacteri | 95.14 | |
| d1uoka2 | 479 | Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 13 | 95.12 | |
| d1ua7a2 | 344 | Bacterial alpha-amylase {Bacillus subtilis [TaxId: | 95.02 | |
| d1tg7a5 | 354 | Beta-galactosidase LacA, N-terminal domain {Penici | 94.88 | |
| d1qhoa4 | 407 | Cyclodextrin glycosyltransferase {Bacillus stearot | 94.84 | |
| d1m53a2 | 478 | Isomaltulose synthase PalI {Klebsiella sp., lx3 [T | 94.83 | |
| d1g94a2 | 354 | Bacterial alpha-amylase {Pseudoalteromonas halopla | 94.71 | |
| d1e43a2 | 393 | Bacterial alpha-amylase {Chimera (Bacillus amyloli | 94.68 | |
| d1g5aa2 | 554 | Amylosucrase {Neisseria polysaccharea [TaxId: 489] | 94.64 | |
| d1gjwa2 | 572 | Maltosyltransferase {Thermotoga maritima [TaxId: 2 | 94.44 | |
| d1ecea_ | 358 | Endocellulase E1 {Acidothermus cellulolyticus [Tax | 94.34 | |
| d1wzaa2 | 409 | Bacterial alpha-amylase {Halothermothrix orenii [T | 94.21 | |
| d1bqca_ | 302 | Beta-mannanase {Thermomonospora fusca [TaxId: 2021 | 94.09 | |
| d1hx0a2 | 403 | Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 982 | 93.84 | |
| d1qwga_ | 251 | (2r)-phospho-3-sulfolactate synthase ComA {Archaeo | 93.78 | |
| d1ceoa_ | 340 | Endoglucanase CelC {Clostridium thermocellum [TaxI | 93.73 | |
| d1jaea2 | 378 | Animal alpha-amylase {Yellow mealworm (Tenebrio mo | 93.55 | |
| d1zy9a2 | 348 | Alpha-galactosidase GalA catalytic domain {Thermot | 93.5 | |
| d2pb1a1 | 394 | Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) | 93.41 | |
| d1qtwa_ | 285 | Endonuclease IV {Escherichia coli [TaxId: 562]} | 93.01 | |
| d1h4pa_ | 408 | Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharom | 92.87 | |
| d2vzsa5 | 339 | Exochitosanase CsxA {Amycolatopsis orientalis [Tax | 92.84 | |
| d1foba_ | 334 | Beta-1,4-galactanase {Fungus (Aspergillus aculeatu | 92.74 | |
| d1tvna1 | 293 | Endoglucanase Cel5a {Pseudoalteromonas haloplankti | 92.19 | |
| d1h1na_ | 305 | Endocellulase EngI {Thermoascus aurantiacus [TaxId | 92.08 | |
| d1yq2a5 | 297 | beta-Galactosidase, domain 3 {Arthrobacter sp. c2- | 91.89 | |
| d7a3ha_ | 300 | Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId | 91.84 | |
| d1x7fa2 | 244 | Outer surface protein, N-terminal domain {Bacillus | 91.79 | |
| d1bhga3 | 304 | beta-Glucuronidase, domain 3 {Human (Homo sapiens) | 91.14 | |
| d2choa2 | 310 | Glucosaminidase GH84, catalytic domain {Bacteroide | 91.14 | |
| d1ji1a3 | 432 | Maltogenic amylase, central domain {Thermoactinomy | 90.98 | |
| d2fhfa5 | 563 | Pullulanase PulA {Klebsiella pneumoniae [TaxId: 57 | 90.45 | |
| d2je8a5 | 348 | Five-domain beta-mannosidase, domain 3 {Bacteroide | 90.4 | |
| d1iv8a2 | 653 | Maltooligosyl trehalose synthase {Archaeon Sulfolo | 89.97 | |
| d1g01a_ | 357 | Alkaline cellulase K catalytic domain {Bacillus sp | 89.95 | |
| d1jz8a5 | 292 | beta-Galactosidase, domain 3 {Escherichia coli [Ta | 89.81 | |
| d1vlia2 | 295 | Spore coat polysaccharide biosynthesis protein Sps | 89.52 | |
| d2cbia2 | 317 | Hyaluronidase catalytic domain {Clostridium perfri | 89.46 | |
| d1m7ya_ | 431 | 1-aminocyclopropane-1-carboxylate synthase (ACC sy | 89.04 | |
| d1i4na_ | 251 | Indole-3-glycerophosphate synthase, IPGS {Thermoto | 88.34 | |
| d1iaya_ | 428 | 1-aminocyclopropane-1-carboxylate synthase (ACC sy | 87.74 | |
| d1xkya1 | 292 | Dihydrodipicolinate synthase {Bacillus anthracis [ | 87.48 | |
| d1piia2 | 254 | Indole-3-glycerophosphate synthase, IPGS {Escheric | 86.7 | |
| d1r57a_ | 102 | Hypothetical protein SA2309 {Staphylococcus aureus | 86.61 | |
| d1hl2a_ | 295 | N-acetylneuraminate lyase {Escherichia coli [TaxId | 86.34 | |
| d1vema2 | 417 | Bacterial beta-amylase {Bacillus cereus [TaxId: 13 | 86.27 | |
| d1w3ia_ | 293 | 2-keto-3-deoxy gluconate aldolase Eda {Sulfolobus | 85.36 | |
| d1a53a_ | 247 | Indole-3-glycerophosphate synthase, IPGS {Archaeon | 85.12 | |
| d2q02a1 | 271 | Putative cytoplasmic protein STM4435 {Salmonella t | 84.91 | |
| d1vffa1 | 423 | Beta-glucosidase A {Archaeon Pyrococcus horikoshii | 84.89 | |
| d1o5ka_ | 295 | Dihydrodipicolinate synthase {Thermotoga maritima | 84.72 | |
| d1r7aa2 | 434 | Sucrose phosphorylase {Bifidobacterium adolescenti | 84.55 | |
| d2a6na1 | 292 | Dihydrodipicolinate synthase {Escherichia coli [Ta | 83.92 | |
| d2j78a1 | 443 | Beta-glucosidase A {Thermotoga maritima [TaxId: 23 | 83.38 | |
| d1e4ia_ | 447 | Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406 | 82.82 | |
| d1egza_ | 291 | Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: | 82.32 | |
| d1e8ga2 | 268 | Vanillyl-alcohol oxidase {Fungus (Penicillium simp | 81.91 | |
| d1f60a3 | 239 | Elongation factor eEF-1alpha, N-terminal (G) domai | 81.5 | |
| d1i60a_ | 278 | Hypothetical protein IolI {Bacillus subtilis [TaxI | 80.47 |
| >d1jaka1 c.1.8.6 (A:151-506) beta-N-acetylhexosaminidase {Streptomyces plicatus [TaxId: 1922]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: (Trans)glycosidases family: beta-N-acetylhexosaminidase catalytic domain domain: beta-N-acetylhexosaminidase species: Streptomyces plicatus [TaxId: 1922]
Probab=100.00 E-value=1.7e-36 Score=244.56 Aligned_cols=124 Identities=16% Similarity=0.140 Sum_probs=106.5
Q ss_pred CCceeEEeecCCCCCCHHHHHHHHHHHHHcCCCEEEEEeeccCCC--CCC---------------CCCCCCCCHHHHHHH
Q psy2348 7 FKEVLVHLDLKGAPPSLTYLKEILPILAYTGATSLLIEWEDTLPY--SLG---------------FDNTNPFRETEIFII 69 (131)
Q Consensus 7 f~~Rg~mlD~~~~~~~~~~lk~~i~~la~~g~n~~~l~~ed~~p~--~~~---------------~~~~~~YT~eeikei 69 (131)
|++||+|||++|||+++++||++||.||.+|+|.+++|+.|...| ... ...+++||++|||+|
T Consensus 1 f~~RG~mlD~aR~f~~~~~i~~~id~ma~~K~N~lh~Hl~D~~~~r~e~~~~p~l~~~ga~~~~~~~~~~~yT~~di~~i 80 (356)
T d1jaka1 1 YAWRSAMLDVSRHFFGVDEVKRYIDRVARYKYNKLHLHLSDDQGWRIAIDSWPRLATYGGSTEVGGGPGGYYTKAEYKEI 80 (356)
T ss_dssp CSEEEEEEECSSSCCCHHHHHHHHHHHHTTTCCEEEEECBCSSCBCBCCTTSTHHHHTTTSCCTTSSCCCCBCHHHHHHH
T ss_pred CCccCeEEEcCCCCcCHHHHHHHHHHHHHcCCeEEEEEEecCCCcceeecCCchhhhccCccccCCCCCCccCHHHHHHH
Confidence 899999999999999999999999999999999999999986433 221 123678999999999
Q ss_pred HHHHHHcCCeEeeccCCcchHHHHhc-cccccccccc-------CCCCceecCCChhHHHHHHHHHhhh
Q psy2348 70 LAAAESNGLASIPLVPLYSDMDFVLK-VKEFAKMRQN-------FNDTRFICPNARSSLDLVFKMIGRL 130 (131)
Q Consensus 70 v~yA~~~~IevIP~i~~~GH~~~~L~-~p~~~~l~e~-------~~~~~~lcp~~~~t~~f~~~ll~ev 130 (131)
++||++|||+||||||+|||+.++++ +|++.+-... ....+.|||++|+|++|+++|++|+
T Consensus 81 v~ya~~rgI~viPEid~PgH~~~~~~~~pel~~~~~~~~~~~~~~~~~~~l~~~~~~t~~f~~~v~~E~ 149 (356)
T d1jaka1 81 VRYAASRHLEVVPEIDMPGHTNAALASYAELNCDGVAPPLYTGTKVGFSSLCVDKDVTYDFVDDVIGEL 149 (356)
T ss_dssp HHHHHHTTCEEEEECCCSSSCHHHHHHCGGGSTTSCCCCCCCSCCCSCCCCCTTCHHHHHHHHHHHHHH
T ss_pred HHHHHHcCCeEeecCCCcchhHHHHHhCccccccCCCCccccccCCCCcccccCchHHHHHHHHHHHHH
Confidence 99999999999999999999999997 7777653221 1234689999999999999999997
|
| >d1nowa1 c.1.8.6 (A:200-552) beta-hexosaminidase B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qbaa3 c.1.8.6 (A:338-780) Bacterial chitobiase (beta-N-acetylhexosaminidase) {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d2gjxa1 c.1.8.6 (A:167-528) beta-hexosaminidase A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yhta1 c.1.8.6 (A:16-359) Dispersin B, DspB {Actinobacillus actinomycetemcomitans [TaxId: 714]} | Back information, alignment and structure |
|---|
| >d1rh9a1 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycopersicon esculentum) [TaxId: 4081]} | Back information, alignment and structure |
|---|
| >d1kwga2 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1wkya2 c.1.8.3 (A:34-330) Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 244966]} | Back information, alignment and structure |
|---|
| >d2bhua3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1uuqa_ c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} | Back information, alignment and structure |
|---|
| >d1eh9a3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1m7xa3 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enzyme, central domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ud2a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1gcya2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]} | Back information, alignment and structure |
|---|
| >d1bf2a3 c.1.8.1 (A:163-637) Isoamylase, central domain {Pseudomonas amyloderamosa [TaxId: 32043]} | Back information, alignment and structure |
|---|
| >d2c0ha1 c.1.8.3 (A:18-367) endo-1,4-beta-mannosidase {Blue mussel (Mytilus edulis) [TaxId: 6550]} | Back information, alignment and structure |
|---|
| >d2aaaa2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus niger, acid amylase [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d1lwha2 c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1j0ha3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2d3na2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 1416]} | Back information, alignment and structure |
|---|
| >d1ht6a2 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]} | Back information, alignment and structure |
|---|
| >d1hjsa_ c.1.8.3 (A:) Beta-1,4-galactanase {Thielavia heterothallica, aka Myceliophthora thermophila [TaxId: 78579]} | Back information, alignment and structure |
|---|
| >d1qnra_ c.1.8.3 (A:) Beta-mannanase {Trichoderma reesei [TaxId: 51453]} | Back information, alignment and structure |
|---|
| >d1ea9c3 c.1.8.1 (C:122-503) Maltogenic amylase, central domain {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d2guya2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]} | Back information, alignment and structure |
|---|
| >d1edga_ c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellulolyticum [TaxId: 1521]} | Back information, alignment and structure |
|---|
| >d1vjza_ c.1.8.3 (A:) Endoglucanase homologue TM1752 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d3bmva4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]} | Back information, alignment and structure |
|---|
| >d1hvxa2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1ur4a_ c.1.8.3 (A:) Beta-1,4-galactanase {Bacillus licheniformis [TaxId: 1402]} | Back information, alignment and structure |
|---|
| >d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei [TaxId: 2262]} | Back information, alignment and structure |
|---|
| >d1wzla3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} | Back information, alignment and structure |
|---|
| >d1h3ga3 c.1.8.1 (A:96-517) Cyclomaltodextrinase, central domain {Flavobacterium sp. 92 [TaxId: 197856]} | Back information, alignment and structure |
|---|
| >d1uoka2 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1ua7a2 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1tg7a5 c.1.8.14 (A:41-394) Beta-galactosidase LacA, N-terminal domain {Penicillium sp. [TaxId: 5081]} | Back information, alignment and structure |
|---|
| >d1qhoa4 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1m53a2 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]} | Back information, alignment and structure |
|---|
| >d1g94a2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]} | Back information, alignment and structure |
|---|
| >d1e43a2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera (Bacillus amyloliquefaciens) and (Bacillus licheniformis) [TaxId: 1390]} | Back information, alignment and structure |
|---|
| >d1g5aa2 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysaccharea [TaxId: 489]} | Back information, alignment and structure |
|---|
| >d1gjwa2 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ecea_ c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]} | Back information, alignment and structure |
|---|
| >d1wzaa2 c.1.8.1 (A:28-436) Bacterial alpha-amylase {Halothermothrix orenii [TaxId: 31909]} | Back information, alignment and structure |
|---|
| >d1bqca_ c.1.8.3 (A:) Beta-mannanase {Thermomonospora fusca [TaxId: 2021]} | Back information, alignment and structure |
|---|
| >d1hx0a2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1qwga_ c.1.27.1 (A:) (2r)-phospho-3-sulfolactate synthase ComA {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1ceoa_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1jaea2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]} | Back information, alignment and structure |
|---|
| >d1zy9a2 c.1.8.13 (A:178-525) Alpha-galactosidase GalA catalytic domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2pb1a1 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) [TaxId: 5476]} | Back information, alignment and structure |
|---|
| >d1qtwa_ c.1.15.1 (A:) Endonuclease IV {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1h4pa_ c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2vzsa5 c.1.8.3 (A:336-674) Exochitosanase CsxA {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|
| >d1foba_ c.1.8.3 (A:) Beta-1,4-galactanase {Fungus (Aspergillus aculeatus) [TaxId: 5053]} | Back information, alignment and structure |
|---|
| >d1tvna1 c.1.8.3 (A:1-293) Endoglucanase Cel5a {Pseudoalteromonas haloplanktis [TaxId: 228]} | Back information, alignment and structure |
|---|
| >d1h1na_ c.1.8.3 (A:) Endocellulase EngI {Thermoascus aurantiacus [TaxId: 5087]} | Back information, alignment and structure |
|---|
| >d1yq2a5 c.1.8.3 (A:313-609) beta-Galactosidase, domain 3 {Arthrobacter sp. c2-2 [TaxId: 192168]} | Back information, alignment and structure |
|---|
| >d7a3ha_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId: 76935]} | Back information, alignment and structure |
|---|
| >d1x7fa2 c.1.8.12 (A:1-244) Outer surface protein, N-terminal domain {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1bhga3 c.1.8.3 (A:329-632) beta-Glucuronidase, domain 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2choa2 c.1.8.10 (A:127-436) Glucosaminidase GH84, catalytic domain {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1ji1a3 c.1.8.1 (A:123-554) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]} | Back information, alignment and structure |
|---|
| >d2fhfa5 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d2je8a5 c.1.8.3 (A:331-678) Five-domain beta-mannosidase, domain 3 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1iv8a2 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1g01a_ c.1.8.3 (A:) Alkaline cellulase K catalytic domain {Bacillus sp. [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1jz8a5 c.1.8.3 (A:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vlia2 c.1.10.6 (A:2-296) Spore coat polysaccharide biosynthesis protein SpsE, N-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2cbia2 c.1.8.10 (A:179-495) Hyaluronidase catalytic domain {Clostridium perfringens [TaxId: 1502]} | Back information, alignment and structure |
|---|
| >d1m7ya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Apple (Malus domestica) [TaxId: 3750]} | Back information, alignment and structure |
|---|
| >d1i4na_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1iaya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Tomato (Lycopersicon esculentum) [TaxId: 4081]} | Back information, alignment and structure |
|---|
| >d1xkya1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Bacillus anthracis [TaxId: 1392]} | Back information, alignment and structure |
|---|
| >d1piia2 c.1.2.4 (A:1-254) Indole-3-glycerophosphate synthase, IPGS {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r57a_ d.108.1.1 (A:) Hypothetical protein SA2309 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1hl2a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vema2 c.1.8.1 (A:1-417) Bacterial beta-amylase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1w3ia_ c.1.10.1 (A:) 2-keto-3-deoxy gluconate aldolase Eda {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1a53a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2q02a1 c.1.15.4 (A:1-271) Putative cytoplasmic protein STM4435 {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1vffa1 c.1.8.4 (A:1-423) Beta-glucosidase A {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1o5ka_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1r7aa2 c.1.8.1 (A:1-434) Sucrose phosphorylase {Bifidobacterium adolescentis [TaxId: 1680]} | Back information, alignment and structure |
|---|
| >d2a6na1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2j78a1 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1e4ia_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406]} | Back information, alignment and structure |
|---|
| >d1egza_ c.1.8.3 (A:) Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1e8ga2 d.145.1.1 (A:6-273) Vanillyl-alcohol oxidase {Fungus (Penicillium simplicissimum) [TaxId: 69488]} | Back information, alignment and structure |
|---|
| >d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1i60a_ c.1.15.4 (A:) Hypothetical protein IolI {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|