Diaphorina citri psyllid: psy2358


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------
MSKENQLTCGKWIAQPIPTDITAKLLGNRVAVSPIVTIEPRRRKFHKPITLTIPVPQAANKGMINQYSGDAPTLRLLCSITGGTARAQWEDVTGTTPLTFVKDCVSFTTTVSARFWLMDCRNVQDSAKMATELYREAIHVPFMAKFVVFAKRIEQLEARLRVFCMTDDKEDKTLEHQEHFTEVAKSRDVEVLEGKSQFVEFAGNLVPVTKSGDQLRLGFRAFRENRLPFTVRVKDPHADVIGRTLFMREPKVSKGEAPQQPICVSKGEAPQQPICVLNIVLPDDIIPETSLPESELTRYQYLTDSSGTARAQWEDVTGTTPLTFVKDCVSFTTTVSARFWLMDCRNVQDSAKMATELYREAIHVPFMAKFVVFAKRIEQLEARLRVFCMTDDKEDKTLEHQEHFTEVAKSRDVELLR
cccccccccccEEcccccHHHHHHHHccccccccEEEEccccccccccEEEEEccccccccccccccccccccEEEEEccccccccccccccccccCEEEEEEEEEEEEEccccEEEEEcccHHHHHHHHHHHHHHHccccEEEEEEEEEEEcccccEEEEEEEEcccccccccccccccccccccccEEEEcccEEEEEECcccccccccccEEEEEEEECcccCEEEEEEEEcccccccCEEEEECcccccccccccccccccccccccccEEEEEEEccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccHHHHHHHHccccccHHHHHHHHHHHHHHHHccccEEEEEEEEEccccccEEEEEEEECccccccccccccccEEEEEcccccccc
******L*CGKWIAQPIPTDITAKLLGNRVAVSPIVTIEPRRRKFHKPITLTIPVPQAANKGMINQYSGDAPTLRLLCSITGGTARAQWEDVTGTTPLTFVKDCVSFTTTVSARFWLMDCRNVQDSAKMATELYREAIHVPFMAKFVVFAKRIEQLEARLRVFCMTDDKEDKTLEHQ******AK**DVEVLEGKSQFVEFAGNLVPVTKSGDQLRLGFRAFRENRLPFTVRVKDPHADVIGRTLFMREP******************APQQPICVLNIVLPDDI********SELTRYQYLTDSS*TARAQWEDVTGTTPLTFVKDCVSFTTTVSARFWLMDCRNVQDSAKMATELYREAIHVPFMAKFVVFAKRIEQLEARLRVFCMTDDKEDKTLEHQEHFTEVAKSRDVELL*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKENQLTCGKWIAQPIPTDITAKLLGNRVAVSPIVTIEPRRRKFHKPITLTIPVPQAANKGMINQYSGDAPTLRLLCSITGGTARAQWEDVTGTTPLTFVKDCVSFTTTVSARFWLMDCRNVQDSAKMATELYREAIHVPFMAKFVVFAKRIEQLEARLRVFCMTDDKEDKTLEHQEHFTEVAKSRDVEVLEGKSQFVEFAGNLVPVTKSGDQLRLGFRAFRENRLPFTVRVKDPHADVIGRTLFMREPKVSKGEAPQQPICVSKGEAPQQPICVLNIVLPDDIIPETSLPESELTRYQYLTDSSGTARAQWEDVTGTTPLTFVKDCVSFTTTVSARFWLMDCRNVQDSAKMATELYREAIHVPFMAKFVVFAKRIEQLEARLRVFCMTDDKEDKTLEHQEHFTEVAKSRDVELLR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ankyrin-2 Attaches integral membrane proteins to cytoskeletal elements. Also binds to cytoskeletal proteins. Required for coordinate assembly of Na/Ca exchanger, Na/K ATPase and InsP3 receptor at sarcoplasmic reticulum sites in cardiomyocytes (By similarity). Required for the coordinated expression of the Na/K ATPase, Na/Ca exchanger and beta-2-spectrin (SPTBN1) in the inner segment of rod photoreceptors. Required for expression and targeting of SPTBN1 in neonatal cardiomyocytes and for the regulation of neonatal cardiomyocyte contraction rate.confidentQ8C8R3
Ankyrin-3 Membrane-cytoskeleton linker. May participate in the maintenance/targeting of ion channels and cell adhesion molecules at the nodes of Ranvier and axonal initial segments.confidentQ12955

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0001508 [BP]regulation of action potentialprobableGO:0019725, GO:0042391, GO:0050801, GO:0009987, GO:0006873, GO:0048878, GO:0042592, GO:0065007, GO:0044763, GO:0008150, GO:0055082, GO:0065008, GO:0044699
GO:0006888 [BP]ER to Golgi vesicle-mediated transportprobableGO:0051234, GO:0016192, GO:0046907, GO:0048193, GO:0006810, GO:0044765, GO:0008150, GO:0051649, GO:0044763, GO:0009987, GO:0051641, GO:0051179, GO:0044699, GO:0016482
GO:0030673 [CC]axolemmaprobableGO:0044304, GO:0016020, GO:0031256, GO:0044463, GO:0031253, GO:0031252, GO:0005623, GO:0030424, GO:0005575, GO:0097458, GO:0032589, GO:0071944, GO:0043005, GO:0033267, GO:0044464, GO:0005886, GO:0042995, GO:0044459, GO:0044425
GO:0033270 [CC]paranode region of axonprobableGO:0044304, GO:0044463, GO:0044464, GO:0005623, GO:0030424, GO:0005575, GO:0097458, GO:0043005, GO:0033267, GO:0042995
GO:0016328 [CC]lateral plasma membraneprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0016323 [CC]basolateral plasma membraneprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0014731 [CC]spectrin-associated cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0045211 [CC]postsynaptic membraneprobableGO:0097060, GO:0044456, GO:0016020, GO:0005575, GO:0045202
GO:0005911 [CC]cell-cell junctionprobableGO:0005575, GO:0030054
GO:0016529 [CC]sarcoplasmic reticulumprobableGO:0005737, GO:0005783, GO:0043229, GO:0044464, GO:0016528, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226, GO:0043231
GO:0022402 [BP]cell cycle processprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699, GO:0007049
GO:0048522 [BP]positive regulation of cellular processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0031594 [CC]neuromuscular junctionprobableGO:0005575, GO:0045202
GO:0051117 [MF]ATPase bindingprobableGO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0072661 [BP]protein targeting to plasma membraneprobableGO:0008104, GO:0006612, GO:0061024, GO:0007009, GO:0090002, GO:0044699, GO:0072659, GO:0070727, GO:0016044, GO:0006886, GO:0016043, GO:0071840, GO:0071702, GO:0033036, GO:0006810, GO:0034613, GO:0006605, GO:0045184, GO:0044765, GO:0044763, GO:0072657, GO:0051649, GO:0051234, GO:0051179, GO:0051641, GO:0046907, GO:0090150, GO:0015031, GO:0008150, GO:0009987
GO:0031430 [CC]M bandprobableGO:0005737, GO:0005575, GO:0043232, GO:0031672, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0030016, GO:0030017, GO:0044444, GO:0043228, GO:0043292, GO:0044424, GO:0043226, GO:0044422, GO:0044449
GO:0032386 [BP]regulation of intracellular transportprobableGO:0060341, GO:0051049, GO:0050794, GO:0065007, GO:0008150, GO:0032879, GO:0050789
GO:0030507 [MF]spectrin bindingprobableGO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0048513 [BP]organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0006812 [BP]cation transportprobableGO:0006811, GO:0006810, GO:0044765, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0030018 [CC]Z discprobableGO:0005737, GO:0005575, GO:0043229, GO:0043232, GO:0044464, GO:0031674, GO:0005623, GO:0005622, GO:0030016, GO:0030017, GO:0044444, GO:0043228, GO:0043292, GO:0044424, GO:0043226, GO:0044422, GO:0044449
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005200 [MF]structural constituent of cytoskeletonprobableGO:0003674, GO:0005198
GO:0030425 [CC]dendriteprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0042383 [CC]sarcolemmaprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886
GO:0030863 [CC]cortical cytoskeletonprobableGO:0005856, GO:0005737, GO:0043228, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0005938, GO:0044424, GO:0043226, GO:0044448
GO:0035637 [BP]multicellular organismal signalingprobableGO:0044700, GO:0032501, GO:0044707, GO:0008150, GO:0023052, GO:0044699
GO:0007411 [BP]axon guidanceprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0042330, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0007409, GO:0048731, GO:0042221, GO:0022008, GO:0048858, GO:0040011, GO:0048699, GO:0032990, GO:0009605, GO:0050896, GO:0048856, GO:0007399, GO:0048812, GO:0044763
GO:0007154 [BP]cell communicationprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0007016 [BP]cytoskeletal anchoring at plasma membraneprobableGO:0006996, GO:0033036, GO:0008104, GO:0007010, GO:0032507, GO:0070727, GO:0009987, GO:0034613, GO:0016043, GO:0045185, GO:0065007, GO:0044763, GO:0071840, GO:0008150, GO:0051235, GO:0065008, GO:0051651, GO:0051179, GO:0044699, GO:0051641

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4D8O, chain A
Confidence level:very confident
Coverage over the Query: 7-250,271-287
View the alignment between query and template
View the model in PyMOL
Template: 4D8O, chain A
Confidence level:very confident
Coverage over the Query: 271-417
View the alignment between query and template
View the model in PyMOL