Diaphorina citri psyllid: psy2363


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150------
MPSGEFARICRDLAQFGESINISCTKEGVKFSATGDIGSANIKLAQTGNVDKEEEAVTVEMQEPVSLNFACRYLLNFAKAAPLSNQEEEAVTVEMQEPVSLNFACRYLLNFAKAAPLSNQVCLSMSLDVPLVVEFKIDDIGHIRYYLAPKIESDDN
ccHHHHHHHHHHHHccccEEEEEEEccEEEEEEEccCEEEEEEEECccccccccccEEEEcccccHHHHHHHHHHHHHcccccccccccEEEEEEcccccEEEEHHHHHHHHcccccccEEEEEECccccEEEEEECcccCEEEEEEccccccccc
*PSGEFARICRDLAQFGESINISCTKEGVKFSATGDIGSANIKLAQTGN******AVTVEMQEPVSLNFACRYLLNFAKAAPL******AVTVEMQEPVSLNFACRYLLNFAKAAPLSNQVCLSMSLDVPLVVEFKIDDIGHIRYYLAPKI*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPSGEFARICRDLAQFGESINISCTKEGVKFSATGDIGSANIKLAQTGNVDKEEEAVTVEMQEPVSLNFACRYLLNFAKAAPLSNQEEEAVTVEMQEPVSLNFACRYLLNFAKAAPLSNQVCLSMSLDVPLVVEFKIDDIGHIRYYLAPKIESDDN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Proliferating cell nuclear antigen This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand. Induces a robust stimulatory effect on the 3'-5' exonuclease and 3'-phosphodiesterase, but not apurinic-apyrimidinic (AP) endonuclease, APEX2 activities. Has to be loaded onto DNA in order to be able to stimulate APEX2.confidentQ3ZBW4
Proliferating cell nuclear antigen This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand. Induces a robust stimulatory effect on the 3'-5' exonuclease and 3'-phosphodiesterase, but not apurinic-apyrimidinic (AP) endonuclease, APEX2 activities (By similarity). Has to be loaded onto DNA in order to be able to stimulate APEX2.confidentP17918
Proliferating cell nuclear antigen This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand.confidentQ9PTP1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0009617 [BP]response to bacteriumprobableGO:0008150, GO:0009607, GO:0050896, GO:0051707, GO:0051704
GO:0006261 [BP]DNA-dependent DNA replicationprobableGO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0006260, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0046483, GO:0044238, GO:0044237, GO:0043170, GO:0006259
GO:0032139 [MF]dinucleotide insertion or deletion bindingprobableGO:0043566, GO:0097159, GO:1901363, GO:0030983, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:0032135, GO:0003690
GO:0006287 [BP]base-excision repair, gap-fillingprobableGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:0044699, GO:0006284, GO:0006281, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0008150, GO:0008152, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0044763
GO:0006298 [BP]mismatch repairprobableGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:0044699, GO:0006281, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0000701 [MF]purine-specific mismatch base pair DNA N-glycosylase activityprobableGO:0016787, GO:0000700, GO:0016799, GO:0019104, GO:0016798, GO:0003824, GO:0003674
GO:0005652 [CC]nuclear laminaprobableGO:0034399, GO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0032077 [BP]positive regulation of deoxyribonuclease activityprobableGO:0032069, GO:0051336, GO:0080090, GO:0051345, GO:0065009, GO:0060255, GO:0032070, GO:0050790, GO:0031323, GO:0032075, GO:0019219, GO:0065007, GO:0051171, GO:0044093, GO:0008150, GO:0019222, GO:0050794, GO:0050789, GO:0043085
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0042276 [BP]error-prone translesion synthesisprobableGO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901576, GO:1901362, GO:1901360, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:0044699, GO:0018130, GO:0006281, GO:0009987, GO:0006725, GO:0006974, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0044238, GO:0044271, GO:0006301, GO:0050896, GO:0019985, GO:0006950, GO:0044237, GO:0043170, GO:0044763, GO:0033554, GO:0006259, GO:0019438, GO:0071897
GO:0000122 [BP]negative regulation of transcription from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0032405 [MF]MutLalpha complex bindingprobableGO:0032403, GO:0003674, GO:0005488, GO:0005515, GO:0032404
GO:0042802 [MF]identical protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0033993 [BP]response to lipidprobableGO:0042221, GO:0050896, GO:0008150, GO:0010033
GO:0070557 [CC]PCNA-p21 complexprobableGO:0043234, GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0043596 [CC]nuclear replication forkprobableGO:0031974, GO:0043229, GO:0043228, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005657, GO:0005694, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3K4X, chain A
Confidence level:very confident
Coverage over the Query: 1-56,91-154
View the alignment between query and template
View the model in PyMOL
Template: 1AXC, chain C
Confidence level:confident
Coverage over the Query: 1-82,117-151
View the alignment between query and template
View the model in PyMOL