Psyllid ID: psy2363

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150------
MPSGEFARICRDLAQFGESINISCTKEGVKFSATGDIGSANIKLAQTGNVDKEEEAVTVEMQEPVSLNFACRYLLNFAKAAPLSNQEEEAVTVEMQEPVSLNFACRYLLNFAKAAPLSNQVCLSMSLDVPLVVEFKIDDIGHIRYYLAPKIESDDN
ccHHHHHHHHHHHHccccEEEEEEEccEEEEEEEccEEEEEEEEEEccccccccccEEEEcccccHHHHHHHHHHHHHcccccccccccEEEEEEcccccEEEEHHHHHHHHHccccccEEEEEEEccccEEEEEEEcccEEEEEEEccccccccc
EEHHHHHHHHHHHHccccEEEEEEEccEEEEEEEccccEEEEEEccEcccccHHHcEEEEEcccEEEEEEHHHHHHHHHHHHcccEcEcccEEcccccEEEEEHHHHHHHHHcccccccEEEEEEcccccEEEEEEcccccEEEEEEccccccccc
MPSGEFARICRDLAQFgesinisctkegvkfsatgdigsaniklaqtgnvdkeeEAVTVEMQEPVSLNFACRYLLNfakaaplsnqeeEAVTVEMQEPVSLNFACRYLLNfakaaplsnqVCLSmsldvplvvefkiddighiryylapkiesddn
MPSGEFARICRDLAQFGESINISCTKEGVKFSATGDIGSANIKLAQTGNVDKEEEAVTVEMQEPVSLNFACRYLLNFAKAAPLSNQEEEAVTVEMQEPVSLNFACRYLLNFAKAAPLSNQVCLSMSLDVPLVVEFKIDDIGHIRYylapkiesddn
MPSGEFARICRDLAQFGESINISCTKEGVKFSATGDIGSANIKLAQTGNVDKEEEAVTVEMQEPVSLNFACRYLLNFAKAAPLSNQEEEAVTVEMQEPVSLNFACRYLLNFAKAAPLSNQVCLSMSLDVPLVVEFKIDDIGHIRYYLAPKIESDDN
*****FARICRDLAQFGESINISCTKEGVKFSATGDIGSANIKLAQTG*******AVTVEMQEPVSLNFACRYLLNFAKAAPL******AVTVEMQEPVSLNFACRYLLNFAKAAPLSNQVCLSMSLDVPLVVEFKIDDIGHIRYYLAP*******
*PSGEFARICRDLAQFGESINISCTKEGVKFSATGDIGSANIKLAQTGN***********MQEPVSLNFACRY*********************MQEPVSLNFACRYLLNFAKAAPLSNQVCLSMSLDVPLVVEFKIDDIGHIRYYLA*KI*****
MPSGEFARICRDLAQFGESINISCTKEGVKFSATGDIGSANIKLAQTGNVDKEEEAVTVEMQEPVSLNFACRYLLNFAKAAPLSNQEEEAVTVEMQEPVSLNFACRYLLNFAKAAPLSNQVCLSMSLDVPLVVEFKIDDIGHIRYYLAPKIESDDN
MPSGEFARICRDLAQFGESINISCTKEGVKFSATGDIGSANIKLAQTGNVDKEEEAVTVEMQEPVSLNFACRYLLNFAKAAPLSNQEEEAVTVEMQEPVSLNFACRYLLNFAKAAPLSNQVCLSMSLDVPLVVEFKIDDIGHIRYYLAPKI*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPSGEFARICRDLAQFGESINISCTKEGVKFSATGDIGSANIKLAQTGNVDKEEEAVTVEMQEPVSLNFACRYLLNFAKAAPLSNQEEEAVTVEMQEPVSLNFACRYLLNFAKAAPLSNQVCLSMSLDVPLVVEFKIDDIGHIRYYLAPKIESDDN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query156 2.2.26 [Sep-21-2011]
O01377260 Proliferating cell nuclea N/A N/A 0.782 0.469 0.602 8e-46
P17917260 Proliferating cell nuclea yes N/A 0.775 0.465 0.593 6e-45
O16852260 Proliferating cell nuclea N/A N/A 0.782 0.469 0.589 3e-44
P61258261 Proliferating cell nuclea N/A N/A 0.775 0.463 0.541 5e-41
P12004261 Proliferating cell nuclea yes N/A 0.775 0.463 0.541 5e-41
P57761261 Proliferating cell nuclea yes N/A 0.775 0.463 0.548 6e-41
P17918261 Proliferating cell nuclea yes N/A 0.775 0.463 0.548 2e-40
P18248261 Proliferating cell nuclea N/A N/A 0.775 0.463 0.535 3e-40
P04961261 Proliferating cell nuclea yes N/A 0.775 0.463 0.541 3e-40
Q3ZBW4261 Proliferating cell nuclea yes N/A 0.775 0.463 0.541 5e-40
>sp|O01377|PCNA_BOMMO Proliferating cell nuclear antigen OS=Bombyx mori GN=PCNA PE=2 SV=1 Back     alignment and function desciption
 Score =  182 bits (462), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 107/156 (68%), Gaps = 34/156 (21%)

Query: 1   MPSGEFARICRDLAQFGESINISCTKEGVKFSATGDIGSANIKLAQTGNVDKEEEAVTVE 60
           MPS EFARICRDL+QFGES+ ISCTKEGVKFSATGDIGSAN+KLAQT ++DKEEE     
Sbjct: 139 MPSSEFARICRDLSQFGESMVISCTKEGVKFSATGDIGSANVKLAQTASIDKEEE----- 193

Query: 61  MQEPVSLNFACRYLLNFAKAAPLSNQEEEAVTVEMQEPVSLNFACRYLLNFAKAAPLSNQ 120
                                        AV +EM+EPV+L FAC+YL  F KA  LS Q
Sbjct: 194 -----------------------------AVVIEMEEPVTLTFACQYLNYFTKATSLSPQ 224

Query: 121 VCLSMSLDVPLVVEFKIDDIGHIRYYLAPKIESDDN 156
           V LSMS DVPLVVE++I DIGHIRYYLAPKIE +D+
Sbjct: 225 VQLSMSADVPLVVEYRIPDIGHIRYYLAPKIEEEDS 260
This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand.
Bombyx mori (taxid: 7091)
>sp|P17917|PCNA_DROME Proliferating cell nuclear antigen OS=Drosophila melanogaster GN=mus209 PE=1 SV=2 Back     alignment and function description
>sp|O16852|PCNA_SARCR Proliferating cell nuclear antigen OS=Sarcophaga crassipalpis GN=PCNA PE=3 SV=1 Back     alignment and function description
>sp|P61258|PCNA_MACFA Proliferating cell nuclear antigen OS=Macaca fascicularis GN=PCNA PE=2 SV=1 Back     alignment and function description
>sp|P12004|PCNA_HUMAN Proliferating cell nuclear antigen OS=Homo sapiens GN=PCNA PE=1 SV=1 Back     alignment and function description
>sp|P57761|PCNA_CRIGR Proliferating cell nuclear antigen OS=Cricetulus griseus GN=PCNA PE=1 SV=1 Back     alignment and function description
>sp|P17918|PCNA_MOUSE Proliferating cell nuclear antigen OS=Mus musculus GN=Pcna PE=1 SV=2 Back     alignment and function description
>sp|P18248|PCNA_XENLA Proliferating cell nuclear antigen OS=Xenopus laevis GN=pcna PE=2 SV=1 Back     alignment and function description
>sp|P04961|PCNA_RAT Proliferating cell nuclear antigen OS=Rattus norvegicus GN=Pcna PE=1 SV=1 Back     alignment and function description
>sp|Q3ZBW4|PCNA_BOVIN Proliferating cell nuclear antigen OS=Bos taurus GN=PCNA PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query156
157167857 260 proliferating cell nuclear antigen [Aede 0.782 0.469 0.621 2e-46
170046021 260 proliferating cell nuclear antigen [Cule 0.782 0.469 0.621 2e-46
67866971 260 proliferating cell nuclear antigen [Aede 0.782 0.469 0.621 4e-46
357611003 260 proliferating cell nuclear antigen [Dana 0.782 0.469 0.615 6e-45
58392487 260 AGAP010220-PA [Anopheles gambiae str. PE 0.782 0.469 0.602 7e-45
312379886 260 hypothetical protein AND_08153 [Anophele 0.782 0.469 0.602 9e-45
122831052 260 proliferating cell nuclear antigen [Fenn 0.782 0.469 0.608 2e-44
339721487 260 proliferating cell nuclear antigen [Lito 0.782 0.469 0.608 2e-44
21717396 260 proliferating cell nuclear antigen [Hyph 0.782 0.469 0.608 3e-44
112984050 260 proliferating cell nuclear antigen [Bomb 0.782 0.469 0.602 5e-44
>gi|157167857|ref|XP_001662644.1| proliferating cell nuclear antigen [Aedes aegypti] gi|67866973|gb|AAY82461.1| proliferating cell nuclear antigen [Aedes aegypti] gi|108871048|gb|EAT35273.1| AAEL012545-PA [Aedes aegypti] Back     alignment and taxonomy information
 Score =  190 bits (482), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 109/156 (69%), Gaps = 34/156 (21%)

Query: 1   MPSGEFARICRDLAQFGESINISCTKEGVKFSATGDIGSANIKLAQTGNVDKEEEAVTVE 60
           MP+ EFARICRDL+QFGES+ ISCTKEGVKFSA+GD GSANIKLAQT +VDKEEEAV +E
Sbjct: 139 MPAIEFARICRDLSQFGESVVISCTKEGVKFSASGDAGSANIKLAQTSSVDKEEEAVVIE 198

Query: 61  MQEPVSLNFACRYLLNFAKAAPLSNQEEEAVTVEMQEPVSLNFACRYLLNFAKAAPLSNQ 120
           MQEPV+L FACRYL +F KA P                                  LS+Q
Sbjct: 199 MQEPVTLTFACRYLNSFTKATP----------------------------------LSSQ 224

Query: 121 VCLSMSLDVPLVVEFKIDDIGHIRYYLAPKIESDDN 156
           V LSMS DVPLVVE+KI D+GHIRYYLAPKIE D+N
Sbjct: 225 VQLSMSADVPLVVEYKIQDLGHIRYYLAPKIEDDEN 260

Source: Aedes aegypti

Species: Aedes aegypti

Genus: Aedes

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|170046021|ref|XP_001850584.1| proliferating cell nuclear antigen [Culex quinquefasciatus] gi|167868946|gb|EDS32329.1| proliferating cell nuclear antigen [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|67866971|gb|AAY82460.1| proliferating cell nuclear antigen [Aedes albopictus] Back     alignment and taxonomy information
>gi|357611003|gb|EHJ67261.1| proliferating cell nuclear antigen [Danaus plexippus] Back     alignment and taxonomy information
>gi|58392487|ref|XP_319407.2| AGAP010220-PA [Anopheles gambiae str. PEST] gi|55236432|gb|EAA13806.2| AGAP010220-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|312379886|gb|EFR26039.1| hypothetical protein AND_08153 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|122831052|gb|ABM66815.1| proliferating cell nuclear antigen [Fenneropenaeus chinensis] Back     alignment and taxonomy information
>gi|339721487|gb|AEJ89927.1| proliferating cell nuclear antigen [Litopenaeus vannamei] gi|339721489|gb|AEJ89928.1| proliferating cell nuclear antigen [Litopenaeus vannamei] Back     alignment and taxonomy information
>gi|21717396|dbj|BAC02930.1| proliferating cell nuclear antigen [Hyphantria cunea] gi|45736601|dbj|BAD13316.1| proliferating cell nuclear antigen [Hyphantria cunea] Back     alignment and taxonomy information
>gi|112984050|ref|NP_001036825.1| proliferating cell nuclear antigen [Bombyx mori] gi|3334291|sp|O01377.1|PCNA_BOMMO RecName: Full=Proliferating cell nuclear antigen; Short=PCNA; AltName: Full=Cyclin gi|1944021|dbj|BAA19522.1| PCNA [Bombyx mori] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query156
FB|FBgn0005655260 mus209 "mutagen-sensitive 209" 0.679 0.407 0.648 3.7e-32
UNIPROTKB|P12004261 PCNA "Proliferating cell nucle 0.621 0.371 0.633 1.5e-28
UNIPROTKB|P61258261 PCNA "Proliferating cell nucle 0.621 0.371 0.633 1.5e-28
UNIPROTKB|P57761261 PCNA "Proliferating cell nucle 0.621 0.371 0.633 2.4e-28
UNIPROTKB|E2R0D6261 PCNA "Uncharacterized protein" 0.621 0.371 0.633 2.4e-28
UNIPROTKB|I3L813261 PCNA "Proliferating cell nucle 0.621 0.371 0.633 2.4e-28
UNIPROTKB|P18248261 pcna "Proliferating cell nucle 0.538 0.321 0.702 2.4e-28
MGI|MGI:97503261 Pcna "proliferating cell nucle 0.621 0.371 0.633 5e-28
RGD|3269261 Pcna "proliferating cell nucle 0.621 0.371 0.623 6.4e-28
UNIPROTKB|Q6B6N4260 pcna "Proliferating cell nucle 0.621 0.373 0.613 6.4e-28
FB|FBgn0005655 mus209 "mutagen-sensitive 209" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 352 (129.0 bits), Expect = 3.7e-32, P = 3.7e-32
 Identities = 70/108 (64%), Positives = 87/108 (80%)

Query:     1 MPSGEFARICRDLAQFGESINISCTKEGVKFSATGDIGSANIKLAQTGNVDKEEEAVTVE 60
             MP+ EFARICRDLAQF ES+ I CTKEGVKFSA+GD+G+ANIKLAQTG+VDKEEEAV +E
Sbjct:   139 MPAMEFARICRDLAQFSESVVICCTKEGVKFSASGDVGTANIKLAQTGSVDKEEEAVIIE 198

Query:    61 MQEPVSLNFACRYLLNFAKAAPLSNQEEEAVTVEMQEPVSLNFACRYL 108
             MQEPV+L FACRYL  F KA PLS Q + ++  ++  P+ + +A + L
Sbjct:   199 MQEPVTLTFACRYLNAFTKATPLSTQVQLSMCADV--PLVVEYAIKDL 244
GO:0006298 "mismatch repair" evidence=TAS
GO:0006261 "DNA-dependent DNA replication" evidence=TAS
GO:0006289 "nucleotide-excision repair" evidence=TAS
GO:0043626 "PCNA complex" evidence=ISS;NAS
GO:0006272 "leading strand elongation" evidence=NAS
GO:0007052 "mitotic spindle organization" evidence=IMP
GO:0006260 "DNA replication" evidence=IMP;TAS
GO:0007307 "eggshell chorion gene amplification" evidence=TAS
GO:0006275 "regulation of DNA replication" evidence=IEA
GO:0030337 "DNA polymerase processivity factor activity" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
GO:0019730 "antimicrobial humoral response" evidence=IMP
GO:0005875 "microtubule associated complex" evidence=IDA
GO:0022008 "neurogenesis" evidence=IMP
UNIPROTKB|P12004 PCNA "Proliferating cell nuclear antigen" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P61258 PCNA "Proliferating cell nuclear antigen" [Macaca fascicularis (taxid:9541)] Back     alignment and assigned GO terms
UNIPROTKB|P57761 PCNA "Proliferating cell nuclear antigen" [Cricetulus griseus (taxid:10029)] Back     alignment and assigned GO terms
UNIPROTKB|E2R0D6 PCNA "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|I3L813 PCNA "Proliferating cell nuclear antigen" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P18248 pcna "Proliferating cell nuclear antigen" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
MGI|MGI:97503 Pcna "proliferating cell nuclear antigen" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|3269 Pcna "proliferating cell nuclear antigen" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q6B6N4 pcna "Proliferating cell nuclear antigen" [Haplochromis burtoni (taxid:8153)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P17917PCNA_DROMENo assigned EC number0.59350.77560.4653yesN/A
Q9PTP1PCNA_DANRENo assigned EC number0.53280.75640.4538yesN/A
Q9DEA3PCNA_CHICKNo assigned EC number0.55260.75640.4503yesN/A
P17918PCNA_MOUSENo assigned EC number0.54830.77560.4636yesN/A
Q3ZBW4PCNA_BOVINNo assigned EC number0.54190.77560.4636yesN/A
P57761PCNA_CRIGRNo assigned EC number0.54830.77560.4636yesN/A
P12004PCNA_HUMANNo assigned EC number0.54190.77560.4636yesN/A
P04961PCNA_RATNo assigned EC number0.54190.77560.4636yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query156
TIGR00590259 TIGR00590, pcna, proliferating cell nuclear antige 1e-59
pfam02747128 pfam02747, PCNA_C, Proliferating cell nuclear anti 2e-59
PLN00057263 PLN00057, PLN00057, proliferating cell nuclear ant 1e-53
cd00577248 cd00577, PCNA, Proliferating Cell Nuclear Antigen 3e-36
PTZ00113275 PTZ00113, PTZ00113, proliferating cell nuclear ant 5e-19
PRK01115247 PRK01115, PRK01115, DNA polymerase sliding clamp; 5e-11
PTZ00483264 PTZ00483, PTZ00483, proliferating cell nuclear ant 2e-10
PHA03383262 PHA03383, PHA03383, PCNA-like protein; Provisional 5e-08
>gnl|CDD|188067 TIGR00590, pcna, proliferating cell nuclear antigen (pcna) Back     alignment and domain information 
 Score =  185 bits (471), Expect = 1e-59
 Identities = 83/155 (53%), Positives = 102/155 (65%), Gaps = 34/155 (21%)

Query: 1   MPSGEFARICRDLAQFGESINISCTKEGVKFSATGDIGSANIKLAQTGNVDKEEEAVTVE 60
           MPS EFARICRDL+QF +S+ ISCTKEGVKFSA GDIGS N+KL QT + DK        
Sbjct: 139 MPSSEFARICRDLSQFSDSVVISCTKEGVKFSAKGDIGSGNVKLKQTSDTDK-------- 190

Query: 61  MQEPVSLNFACRYLLNFAKAAPLSNQEEEAVTVEMQEPVSLNFACRYLLNFAKAAPLSNQ 120
                                     EEEAVT+EM++PV+L FA +YL  F KA PLS++
Sbjct: 191 --------------------------EEEAVTIEMKQPVTLTFAIKYLNLFTKATPLSDR 224

Query: 121 VCLSMSLDVPLVVEFKIDDIGHIRYYLAPKIESDD 155
           V LSMS DVPLVVE+KI D+G +R++LAPKIE ++
Sbjct: 225 VTLSMSNDVPLVVEYKIKDMGFLRFFLAPKIEDEE 259

All proteins in this family for which functions are known form sliding DNA clamps that are used in DNA replication processes. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University) [DNA metabolism, DNA replication, recombination, and repair]. Length = 259
>gnl|CDD|202372 pfam02747, PCNA_C, Proliferating cell nuclear antigen, C-terminal domain Back     alignment and domain information
>gnl|CDD|177688 PLN00057, PLN00057, proliferating cell nuclear antigen; Provisional Back     alignment and domain information
>gnl|CDD|238322 cd00577, PCNA, Proliferating Cell Nuclear Antigen (PCNA) domain found in eukaryotes and archaea Back     alignment and domain information
>gnl|CDD|240275 PTZ00113, PTZ00113, proliferating cell nuclear antigen; Provisional Back     alignment and domain information
>gnl|CDD|234903 PRK01115, PRK01115, DNA polymerase sliding clamp; Validated Back     alignment and domain information
>gnl|CDD|185661 PTZ00483, PTZ00483, proliferating cell nuclear antigen; Provisional Back     alignment and domain information
>gnl|CDD|177619 PHA03383, PHA03383, PCNA-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 156
KOG1636|consensus260 100.0
PF02747128 PCNA_C: Proliferating cell nuclear antigen, C-term 100.0
PTZ00113275 proliferating cell nuclear antigen; Provisional 99.98
PLN00057263 proliferating cell nuclear antigen; Provisional 99.97
TIGR00590259 pcna proliferating cell nuclear antigen (pcna). Al 99.97
PTZ00483264 proliferating cell nuclear antigen; Provisional 99.97
PHA03383262 PCNA-like protein; Provisional 99.96
PRK01115247 DNA polymerase sliding clamp; Validated 99.77
cd00577248 PCNA Proliferating Cell Nuclear Antigen (PCNA) dom 99.63
cd00140365 beta_clamp Beta clamp domain. The beta subunit (pr 98.27
COG0592364 DnaN DNA polymerase sliding clamp subunit (PCNA ho 98.24
PRK05643367 DNA polymerase III subunit beta; Validated 98.03
KOG3194|consensus279 97.88
PTZ00113275 proliferating cell nuclear antigen; Provisional 97.78
PF02144275 Rad1: Repair protein Rad1/Rec1/Rad17; InterPro: IP 97.71
PF02768121 DNA_pol3_beta_3: DNA polymerase III beta subunit, 97.7
TIGR00590259 pcna proliferating cell nuclear antigen (pcna). Al 97.48
PF02747128 PCNA_C: Proliferating cell nuclear antigen, C-term 97.45
PF00705127 PCNA_N: Proliferating cell nuclear antigen, N-term 97.4
cd00577 248 PCNA Proliferating Cell Nuclear Antigen (PCNA) dom 97.37
PRK14945362 DNA polymerase III subunit beta; Provisional 96.85
PF04005292 Hus1: Hus1-like protein; InterPro: IPR007150 Hus1, 96.75
smart00480345 POL3Bc DNA polymerase III beta subunit. 96.43
PTZ00483264 proliferating cell nuclear antigen; Provisional 96.42
PLN00057 263 proliferating cell nuclear antigen; Provisional 96.24
PHA03383 262 PCNA-like protein; Provisional 96.07
PRK14947384 DNA polymerase III subunit beta; Provisional 96.04
PRK14940367 DNA polymerase III subunit beta; Provisional 95.43
PRK14941374 DNA polymerase III subunit beta; Provisional 94.84
PRK14943374 DNA polymerase III subunit beta; Provisional 94.81
PRK06673376 DNA polymerase III subunit beta; Validated 94.76
PRK14942373 DNA polymerase III subunit beta; Provisional 94.38
KOG1636|consensus260 94.29
PRK07761376 DNA polymerase III subunit beta; Validated 94.26
PRK01115 247 DNA polymerase sliding clamp; Validated 94.21
PRK14946366 DNA polymerase III subunit beta; Provisional 94.15
TIGR00663367 dnan DNA polymerase III, beta subunit. University) 93.31
PRK14944375 DNA polymerase III subunit beta; Provisional 92.19
PF04139252 Rad9: Rad9; InterPro: IPR007268 Rad9 is required f 91.59
PF04005 292 Hus1: Hus1-like protein; InterPro: IPR007150 Hus1, 90.82
PF04139252 Rad9: Rad9; InterPro: IPR007268 Rad9 is required f 84.44
>KOG1636|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.4e-38  Score=261.41  Aligned_cols=122  Identities=64%  Similarity=1.073  Sum_probs=112.7

Q ss_pred             CCcHHHHHHHHHHhccCCeEEEEEeCCeEEEEEeecceeEEEEEeecCCCCCCCccEEEEecCceeEEeeeeecccccCC
Q psy2363           1 MPSGEFARICRDLAQFGESINISCTKEGVKFSATGDIGSANIKLAQTGNVDKEEEAVTVEMQEPVSLNFACRYLLNFAKA   80 (156)
Q Consensus         1 m~s~~f~~i~rdl~~~gd~v~i~~~~~~v~f~~~gd~~~~~i~l~~~~~~~~~~~~v~i~~~~~~~~~fs~k~~~~~~k~   80 (156)
                      |||+||+||||||+.|||+|+|.+++++|+|+++||+|+++|.+++....+++                           
T Consensus       139 mPa~EF~ricrdls~f~Dsv~I~~tkegv~F~~~Gdig~asi~l~~~~~~d~~---------------------------  191 (260)
T KOG1636|consen  139 MPAGEFSRICRDLSTFSDSVVISATKEGVKFSAKGDIGTASITLSQCTAVDKP---------------------------  191 (260)
T ss_pred             ccHHHHHHHHHHHhhhcCeEEEEEecceeEEEecccccceeEEEccCCCCCCc---------------------------
Confidence            89999999999999999999999999999999999999999999887655444                           


Q ss_pred             CCCCcccccceEEEecCceeeeeehhhHHhhhhhcCCCceEEEEeeCCCcEEEEEEeCCCeEEEEEEeeccCCCCC
Q psy2363          81 APLSNQEEEAVTVEMQEPVSLNFACRYLLNFAKAAPLSNQVCLSMSLDVPLVVEFKIDDIGHIRYYLAPKIESDDN  156 (156)
Q Consensus        81 ~~~~~~~~~~V~i~~~~~V~l~Fa~~~L~~f~Kaa~ls~~V~l~l~~~~Pl~v~f~i~~~G~l~~yLAPki~~e~~  156 (156)
                             ++.|+|+|++||+|+||+|||+.|+||++||++|+|+|+++.|+.|+|++.+.|||||||||||+++++
T Consensus       192 -------e~av~iE~~~pVtltfa~kYln~ftKatpLs~rV~lsls~~~P~~vey~i~~~g~lr~YLAPKieD~e~  260 (260)
T KOG1636|consen  192 -------EEAVKIEMNEPVTLTFALKYLNQFTKATPLSDRVTLSLSSEVPVVVEYKIEDMGHLRYYLAPKIEDEED  260 (260)
T ss_pred             -------cceEEEEecCcchhhhHHHHHHHhhccccccceEEEEecCCCcEEEEEecccCceEEEEEccccCCCCC
Confidence                   455667777789999999999999999999999999999999999999999999999999999998764

>PF02747 PCNA_C: Proliferating cell nuclear antigen, C-terminal domain; InterPro: IPR022649 Proliferating cell nuclear antigen (PCNA), or cyclin, is a non-histone acidic nuclear protein [] that plays a key role in the control of eukaryotic DNA replication [] Back     alignment and domain information
>PTZ00113 proliferating cell nuclear antigen; Provisional Back     alignment and domain information
>PLN00057 proliferating cell nuclear antigen; Provisional Back     alignment and domain information
>TIGR00590 pcna proliferating cell nuclear antigen (pcna) Back     alignment and domain information
>PTZ00483 proliferating cell nuclear antigen; Provisional Back     alignment and domain information
>PHA03383 PCNA-like protein; Provisional Back     alignment and domain information
>PRK01115 DNA polymerase sliding clamp; Validated Back     alignment and domain information
>cd00577 PCNA Proliferating Cell Nuclear Antigen (PCNA) domain found in eukaryotes and archaea Back     alignment and domain information
>cd00140 beta_clamp Beta clamp domain Back     alignment and domain information
>COG0592 DnaN DNA polymerase sliding clamp subunit (PCNA homolog) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05643 DNA polymerase III subunit beta; Validated Back     alignment and domain information
>KOG3194|consensus Back     alignment and domain information
>PTZ00113 proliferating cell nuclear antigen; Provisional Back     alignment and domain information
>PF02144 Rad1: Repair protein Rad1/Rec1/Rad17; InterPro: IPR003021 REC1 of Ustilago maydis plays a key role in regulating the genetic system of the fungus Back     alignment and domain information
>PF02768 DNA_pol3_beta_3: DNA polymerase III beta subunit, C-terminal domain; InterPro: IPR022635 This entry describes the C-terminal domain of the beta chain of DNA polymerase III Back     alignment and domain information
>TIGR00590 pcna proliferating cell nuclear antigen (pcna) Back     alignment and domain information
>PF02747 PCNA_C: Proliferating cell nuclear antigen, C-terminal domain; InterPro: IPR022649 Proliferating cell nuclear antigen (PCNA), or cyclin, is a non-histone acidic nuclear protein [] that plays a key role in the control of eukaryotic DNA replication [] Back     alignment and domain information
>PF00705 PCNA_N: Proliferating cell nuclear antigen, N-terminal domain; InterPro: IPR022648 Proliferating cell nuclear antigen (PCNA), or cyclin, is a non-histone acidic nuclear protein [] that plays a key role in the control of eukaryotic DNA replication [] Back     alignment and domain information
>cd00577 PCNA Proliferating Cell Nuclear Antigen (PCNA) domain found in eukaryotes and archaea Back     alignment and domain information
>PRK14945 DNA polymerase III subunit beta; Provisional Back     alignment and domain information
>PF04005 Hus1: Hus1-like protein; InterPro: IPR007150 Hus1, Rad1, and Rad9 are three evolutionarily conserved proteins required for checkpoint control in fission yeast Back     alignment and domain information
>smart00480 POL3Bc DNA polymerase III beta subunit Back     alignment and domain information
>PTZ00483 proliferating cell nuclear antigen; Provisional Back     alignment and domain information
>PLN00057 proliferating cell nuclear antigen; Provisional Back     alignment and domain information
>PHA03383 PCNA-like protein; Provisional Back     alignment and domain information
>PRK14947 DNA polymerase III subunit beta; Provisional Back     alignment and domain information
>PRK14940 DNA polymerase III subunit beta; Provisional Back     alignment and domain information
>PRK14941 DNA polymerase III subunit beta; Provisional Back     alignment and domain information
>PRK14943 DNA polymerase III subunit beta; Provisional Back     alignment and domain information
>PRK06673 DNA polymerase III subunit beta; Validated Back     alignment and domain information
>PRK14942 DNA polymerase III subunit beta; Provisional Back     alignment and domain information
>KOG1636|consensus Back     alignment and domain information
>PRK07761 DNA polymerase III subunit beta; Validated Back     alignment and domain information
>PRK01115 DNA polymerase sliding clamp; Validated Back     alignment and domain information
>PRK14946 DNA polymerase III subunit beta; Provisional Back     alignment and domain information
>TIGR00663 dnan DNA polymerase III, beta subunit Back     alignment and domain information
>PRK14944 DNA polymerase III subunit beta; Provisional Back     alignment and domain information
>PF04139 Rad9: Rad9; InterPro: IPR007268 Rad9 is required for transient cell-cycle arrests and transcriptional induction of DNA repair in response to DNA damage Back     alignment and domain information
>PF04005 Hus1: Hus1-like protein; InterPro: IPR007150 Hus1, Rad1, and Rad9 are three evolutionarily conserved proteins required for checkpoint control in fission yeast Back     alignment and domain information
>PF04139 Rad9: Rad9; InterPro: IPR007268 Rad9 is required for transient cell-cycle arrests and transcriptional induction of DNA repair in response to DNA damage Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query156
1axc_C261 Human Pcna Length = 261 4e-42
1axc_A261 Human Pcna Length = 261 4e-42
2zvw_A275 Crystal Structure Of Proliferating Cell Nuclear Ant 1e-34
2zvv_A276 Crystal Structure Of Proliferating Cellular Nuclear 1e-34
3f1w_A258 Crystal Structure Of A Mutant Proliferating Cell Nu 2e-17
2od8_A258 Structure Of A Peptide Derived From Cdc9 Bound To P 2e-17
3gpm_A258 Structure Of The Trimeric Form Of The E113g Pcna Mu 2e-17
3v60_B258 Structure Of S. Cerevisiae Pcna Conjugated To Sumo 2e-17
3k4x_A 798 Eukaryotic Sliding Clamp Pcna Bound To Dna Length = 3e-17
1sxj_F283 Crystal Structure Of The Eukaryotic Clamp Loader (R 3e-17
3p91_A265 Crystal Structure Of Proliferating Cellular Nuclear 1e-10
3pge_A200 Structure Of Sumoylated Pcna Length = 200 4e-09
3l0w_B169 Structure Of Split Monoubiquitinated Pcna With Ubiq 6e-09
3l0x_B94 Structure Of Split Yeast Pcna Length = 94 7e-09
3lx1_A255 Crystal Structure Analysis Of Pcna1 From Thermococc 5e-05
>pdb|1AXC|C Chain C, Human Pcna Length = 261 Back     alignment and structure 
Iteration: 1

 Score =  166 bits (421), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 102/155 (65%), Gaps = 34/155 (21%)
Query: 1   MPSGEFARICRDLAQFGESINISCTKEGVKFSATGDIGSANIKLAQTGNVDKEEEAVTVE 60
           MPSGEFARICRDL+  G+++ ISC K+GVKFSA+G++G+ NIKL+QT NVDKEEEAVT+E
Sbjct: 139 MPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIE 198
Query: 61  MQEPVSLNFACRYLLNFAKAAPLSNQEEEAVTVEMQEPVSLNFACRYLLNFAKAAPLSNQ 120
           M EPV L FA RYL  F KA P                                  LS+ 
Sbjct: 199 MNEPVQLTFALRYLNFFTKATP----------------------------------LSST 224
Query: 121 VCLSMSLDVPLVVEFKIDDIGHIRYYLAPKIESDD 155
           V LSMS DVPLVVE+KI D+GH++YYLAPKIE ++
Sbjct: 225 VTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEE 259
>pdb|1AXC|A Chain A, Human Pcna Length = 261 Back     alignment and structure
>pdb|2ZVW|A Chain A, Crystal Structure Of Proliferating Cell Nuclear Antigen 2 And Short Peptide From Human P21 Length = 275 Back     alignment and structure
>pdb|2ZVV|A Chain A, Crystal Structure Of Proliferating Cellular Nuclear Antigen 1 And Short Peptide From Human P21 Length = 276 Back     alignment and structure
>pdb|3F1W|A Chain A, Crystal Structure Of A Mutant Proliferating Cell Nuclear Antigen That Blocks Translesion Synthesis Length = 258 Back     alignment and structure
>pdb|2OD8|A Chain A, Structure Of A Peptide Derived From Cdc9 Bound To Pcna Length = 258 Back     alignment and structure
>pdb|3GPM|A Chain A, Structure Of The Trimeric Form Of The E113g Pcna Mutant Protein Length = 258 Back     alignment and structure
>pdb|3V60|B Chain B, Structure Of S. Cerevisiae Pcna Conjugated To Sumo On Lysine 164 Length = 258 Back     alignment and structure
>pdb|3K4X|A Chain A, Eukaryotic Sliding Clamp Pcna Bound To Dna Length = 798 Back     alignment and structure
>pdb|1SXJ|F Chain F, Crystal Structure Of The Eukaryotic Clamp Loader (Replication Factor C, Rfc) Bound To The Dna Sliding Clamp (Proliferating Cell Nuclear Antigen, Pcna) Length = 283 Back     alignment and structure
>pdb|3P91|A Chain A, Crystal Structure Of Proliferating Cellular Nuclear Antigen From Entamoeba Histolytica Length = 265 Back     alignment and structure
>pdb|3PGE|A Chain A, Structure Of Sumoylated Pcna Length = 200 Back     alignment and structure
>pdb|3L0W|B Chain B, Structure Of Split Monoubiquitinated Pcna With Ubiquitin In Position Two Length = 169 Back     alignment and structure
>pdb|3L0X|B Chain B, Structure Of Split Yeast Pcna Length = 94 Back     alignment and structure
>pdb|3LX1|A Chain A, Crystal Structure Analysis Of Pcna1 From Thermococcus Kodakaraensis Tk0535 Length = 255 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query156
3l0w_B169 Monoubiquitinated proliferating cell nuclear antig 1e-31
1u7b_A261 PCNA, cyclin, proliferating cell nuclear antigen; 1e-25
3fds_C249 DNA polymerase sliding clamp B; protein-protein co 2e-25
1plq_A258 Proliferating cell nuclear antigen (PCNA); DNA-bin 1e-24
3pge_A200 SUMO-modified proliferating cell nuclear antigen; 2e-24
3k4x_A798 PCNA, proliferating cell nuclear antigen; DNA repl 2e-23
3k4x_A 798 PCNA, proliferating cell nuclear antigen; DNA repl 2e-20
3k4x_A 798 PCNA, proliferating cell nuclear antigen; DNA repl 4e-20
2zvv_A276 PCNA 1, proliferating cellular nuclear antigen 1; 4e-23
3lx2_A259 DNA polymerase sliding clamp 2; PCNA, DNA processi 6e-23
1iz5_A249 Proliferating cell nuclear antigen; DNA, replicati 1e-21
3p91_A265 Proliferating cell nuclear antigen; DNA binding pr 5e-21
3aiz_C246 DNA polymerase sliding clamp C; protein-protein co 2e-20
3aiz_A248 DNA polymerase sliding clamp B; protein-protein co 3e-20
3fds_D245 DNA polymerase sliding clamp C; protein-protein co 4e-20
2ijx_A244 DNA polymerase sliding clamp A; PCNA3 subunit, pro 8e-20
3ifv_A247 PCNA; processivity factor, sliding clamp, halophil 4e-19
1ud9_A245 DNA polymerase sliding clamp A; DNA-binding, DNA r 6e-19
1rwz_A245 DNA polymerase sliding clamp; torus, processivity 6e-19
3a1j_C263 Cell cycle checkpoint protein RAD1; DNA damage, DN 1e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
3g65_A296 Cell cycle checkpoint control protein RAD9A; PCNA, 2e-05
3a1j_A266 Cell cycle checkpoint control protein RAD9A; DNA d 2e-05
>3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B Length = 169 Back     alignment and structure
 Score =  110 bits (276), Expect = 1e-31
 Identities = 36/158 (22%), Positives = 63/158 (39%), Gaps = 41/158 (25%)

Query: 1   MPSGEFARICRDLAQFGESINISCTK------EGVKFSATGDIGSANIKLAQTGNVDKEE 54
               E  R   D     ES      +      E +KF A GDIGS ++ +    +++   
Sbjct: 47  GKQLEDGRTLSDYNIQKESTLHLVLRLRGGGGETIKFVADGDIGSGSVIIKPFVDME--- 103

Query: 55  EAVTVEMQEPVSLNFACRYLLNFAKAAPLSNQEEEAVTVEMQEPVSLNFACRYLLNFAKA 114
                                            E ++ +EM +PV L F  +YLL+  K 
Sbjct: 104 -------------------------------HPETSIKLEMDQPVDLTFGAKYLLDIIKG 132

Query: 115 APLSNQVCLSMSLDVPLVVEFKIDDIGHIRYYLAPKIE 152
           + LS++V + +S + P + +F +   G ++++LAPK  
Sbjct: 133 SSLSDRVGIRLSSEAPALFQFDLKS-GFLQFFLAPKFN 169
>1u7b_A PCNA, cyclin, proliferating cell nuclear antigen; sliding clamp, DNA processing, FEN1, PIP- BOX, replication; 1.88A {Homo sapiens} SCOP: d.131.1.2 d.131.1.2 PDB: 1u76_A 1axc_A 1ul1_A 1vyj_A 1vym_A 1w60_A 2zvk_A* 2zvl_A* 2zvm_A* 3p87_A 3vkx_A* Length = 261 Back     alignment and structure
>3fds_C DNA polymerase sliding clamp B; protein-protein complex, DNA damage, DNA repair, DNA replica DNA-binding, DNA-directed DNA polymerase; HET: DNA 1PE PGE; 2.05A {Sulfolobus solfataricus} PDB: 2io4_A* 2nti_D* 2hii_A 2hik_A 2ix2_A* 2izo_C* Length = 249 Back     alignment and structure
>1plq_A Proliferating cell nuclear antigen (PCNA); DNA-binding, nuclear protein, DNA replication, processivity; 2.30A {Saccharomyces cerevisiae} SCOP: d.131.1.2 d.131.1.2 PDB: 1plr_A 2od8_A* 1sxj_F* 3f1w_A 3v60_B 3v61_B 3v62_B* 3gpn_A 3gpm_A 3l0w_A 3l0x_A 3l10_A 3pge_B 3l0x_B Length = 258 Back     alignment and structure
>3pge_A SUMO-modified proliferating cell nuclear antigen; DNA replication, DNA binding protein; 2.80A {Saccharomyces cerevisiae} Length = 200 Back     alignment and structure
>3k4x_A PCNA, proliferating cell nuclear antigen; DNA replication, DNA-binding; HET: DNA; 2.98A {Saccharomyces cerevisiae} Length = 798 Back     alignment and structure
>3k4x_A PCNA, proliferating cell nuclear antigen; DNA replication, DNA-binding; HET: DNA; 2.98A {Saccharomyces cerevisiae} Length = 798 Back     alignment and structure
>3k4x_A PCNA, proliferating cell nuclear antigen; DNA replication, DNA-binding; HET: DNA; 2.98A {Saccharomyces cerevisiae} Length = 798 Back     alignment and structure
>2zvv_A PCNA 1, proliferating cellular nuclear antigen 1; protein-peptide complex, DNA replication, DNA-binding, nucleus, DNA binding protein; 2.00A {Arabidopsis thaliana} PDB: 2zvw_A Length = 276 Back     alignment and structure
>3lx2_A DNA polymerase sliding clamp 2; PCNA, DNA processivity factor, trimer, toroidal, DNA replica DNA-binding, DNA binding protein; HET: DNA; 2.40A {Thermococcus kodakarensis} Length = 259 Back     alignment and structure
>1iz5_A Proliferating cell nuclear antigen; DNA, replication, processivity, sliding clamp, DNA binding protein; 1.80A {Pyrococcus furiosus} SCOP: d.131.1.2 d.131.1.2 PDB: 3a2f_B* 1iz4_A 1ge8_A 1isq_A 3lx1_A* Length = 249 Back     alignment and structure
>3p91_A Proliferating cell nuclear antigen; DNA binding protein, DNA replication, processivity, sliding; 2.40A {Entamoeba histolytica} Length = 265 Back     alignment and structure
>3aiz_C DNA polymerase sliding clamp C; protein-protein complex, replication; HET: DNA; 2.80A {Sulfolobus tokodaii} PDB: 3aix_A* Length = 246 Back     alignment and structure
>3aiz_A DNA polymerase sliding clamp B; protein-protein complex, replication; HET: DNA; 2.80A {Sulfolobus tokodaii} PDB: 3aix_B* Length = 248 Back     alignment and structure
>3fds_D DNA polymerase sliding clamp C; protein-protein complex, DNA damage, DNA repair, DNA replica DNA-binding, DNA-directed DNA polymerase; HET: DNA 1PE PGE; 2.05A {Sulfolobus solfataricus} PDB: 2nti_E* 2io4_B* 2ix2_B* 2hik_B 2hii_B* 2izo_B* Length = 245 Back     alignment and structure
>2ijx_A DNA polymerase sliding clamp A; PCNA3 subunit, protein-protein interaction, PCNA123 heterotr binding protein; HET: DNA; 1.90A {Sulfolobus solfataricus} PDB: 2nti_F* 2hii_C 2hik_C 2ix2_C* Length = 244 Back     alignment and structure
>3ifv_A PCNA; processivity factor, sliding clamp, halophilic, replication; 2.00A {Haloferax volcanii} PDB: 3hi8_A Length = 247 Back     alignment and structure
>1ud9_A DNA polymerase sliding clamp A; DNA-binding, DNA replication, DNA binding protein; HET: DNA; 1.68A {Sulfolobus tokodaii} SCOP: d.131.1.2 d.131.1.2 Length = 245 Back     alignment and structure
>1rwz_A DNA polymerase sliding clamp; torus, processivity factor, replication; HET: DNA; 1.80A {Archaeoglobus fulgidus} SCOP: d.131.1.2 d.131.1.2 PDB: 1rxm_A* 1rxz_A* 3p83_A* Length = 245 Back     alignment and structure
>3a1j_C Cell cycle checkpoint protein RAD1; DNA damage, DNA repair, exonuclease, hydrolase, nuclease, nucleus, phosphoprotein, polymorphism, cytoplasm; HET: SUC; 2.50A {Homo sapiens} PDB: 3g65_B 3ggr_C Length = 263 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3g65_A Cell cycle checkpoint control protein RAD9A; PCNA, DNA binding clamp, DNA damage, DNA repair, exonuclease, hydrolase, nuclease, nucleus, phosphoprotein; 2.90A {Homo sapiens} Length = 296 Back     alignment and structure
>3a1j_A Cell cycle checkpoint control protein RAD9A; DNA damage, DNA repair, exonuclease, hydrolase, nuclease, nucleus, phosphoprotein, polymorphism, cytoplasm; HET: SUC; 2.50A {Homo sapiens} PDB: 3ggr_A Length = 266 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query156
3fds_C249 DNA polymerase sliding clamp B; protein-protein co 99.95
3k4x_A 798 PCNA, proliferating cell nuclear antigen; DNA repl 99.95
3pge_A200 SUMO-modified proliferating cell nuclear antigen; 99.95
3p91_A265 Proliferating cell nuclear antigen; DNA binding pr 99.95
3k4x_A798 PCNA, proliferating cell nuclear antigen; DNA repl 99.94
3l0w_B169 Monoubiquitinated proliferating cell nuclear antig 99.94
3ifv_A247 PCNA; processivity factor, sliding clamp, halophil 99.93
3lx2_A259 DNA polymerase sliding clamp 2; PCNA, DNA processi 99.92
3fds_D245 DNA polymerase sliding clamp C; protein-protein co 99.92
1plq_A258 Proliferating cell nuclear antigen (PCNA); DNA-bin 99.91
3a1j_C263 Cell cycle checkpoint protein RAD1; DNA damage, DN 99.9
1u7b_A261 PCNA, cyclin, proliferating cell nuclear antigen; 99.9
2zvv_A276 PCNA 1, proliferating cellular nuclear antigen 1; 99.89
3a1j_B281 HHUS1, checkpoint protein HUS1; DNA damage, DNA re 99.82
1iz5_A249 Proliferating cell nuclear antigen; DNA, replicati 99.82
3aiz_A248 DNA polymerase sliding clamp B; protein-protein co 99.8
3aiz_C246 DNA polymerase sliding clamp C; protein-protein co 99.8
1rwz_A245 DNA polymerase sliding clamp; torus, processivity 99.79
2ijx_A244 DNA polymerase sliding clamp A; PCNA3 subunit, pro 99.78
1ud9_A245 DNA polymerase sliding clamp A; DNA-binding, DNA r 99.78
3a1j_A266 Cell cycle checkpoint control protein RAD9A; DNA d 99.59
3g65_A296 Cell cycle checkpoint control protein RAD9A; PCNA, 98.54
1vpk_A378 DNA polymerase III, beta subunit; TM0262, structur 98.33
2avt_A378 DNA polymerase III beta subunit; beta clamp, slidi 98.14
3d1g_A366 DNA polymerase III subunit beta; chemical probe, D 98.12
3l0w_B169 Monoubiquitinated proliferating cell nuclear antig 97.82
3pge_A200 SUMO-modified proliferating cell nuclear antigen; 97.69
3t0p_A371 DNA polymerase III, beta subunit; DNA clamp, struc 97.47
3p91_A 265 Proliferating cell nuclear antigen; DNA binding pr 96.99
3a1j_C 263 Cell cycle checkpoint protein RAD1; DNA damage, DN 96.56
3lx2_A 259 DNA polymerase sliding clamp 2; PCNA, DNA processi 96.51
3fds_D 245 DNA polymerase sliding clamp C; protein-protein co 96.45
1u7b_A 261 PCNA, cyclin, proliferating cell nuclear antigen; 96.42
3p16_A408 DNA polymerase III subunit beta; DNA polymerase II 96.35
1plq_A 258 Proliferating cell nuclear antigen (PCNA); DNA-bin 96.32
2zvv_A 276 PCNA 1, proliferating cellular nuclear antigen 1; 96.11
3fds_C 249 DNA polymerase sliding clamp B; protein-protein co 96.03
3a1j_B 281 HHUS1, checkpoint protein HUS1; DNA damage, DNA re 95.98
1iz5_A249 Proliferating cell nuclear antigen; DNA, replicati 95.69
3aiz_C246 DNA polymerase sliding clamp C; protein-protein co 94.66
3aiz_A 248 DNA polymerase sliding clamp B; protein-protein co 94.44
3a1j_A 266 Cell cycle checkpoint control protein RAD9A; DNA d 93.95
1ud9_A245 DNA polymerase sliding clamp A; DNA-binding, DNA r 93.49
2ijx_A244 DNA polymerase sliding clamp A; PCNA3 subunit, pro 93.47
3ifv_A247 PCNA; processivity factor, sliding clamp, halophil 93.13
1rwz_A245 DNA polymerase sliding clamp; torus, processivity 92.89
3g65_A 296 Cell cycle checkpoint control protein RAD9A; PCNA, 80.28
3izc_W121 60S ribosomal protein RPL22 (L22E); eukaryotic rib 80.18
>3fds_C DNA polymerase sliding clamp B; protein-protein complex, DNA damage, DNA repair, DNA replica DNA-binding, DNA-directed DNA polymerase; HET: DNA 1PE PGE; 2.05A {Sulfolobus solfataricus} PDB: 2io4_A* 2nti_D* 2hii_A 2hik_A 2ix2_A* 2izo_C* Back     alignment and structure
Probab=99.95  E-value=6.5e-28  Score=197.98  Aligned_cols=111  Identities=16%  Similarity=0.291  Sum_probs=98.4

Q ss_pred             CCcHHHHHHHHHHhccCCeEEEEEeCCeEEEEEeecceeEEEEEeecCCCCCCCccEEEEecCceeEEeeeeecccccCC
Q psy2363           1 MPSGEFARICRDLAQFGESINISCTKEGVKFSATGDIGSANIKLAQTGNVDKEEEAVTVEMQEPVSLNFACRYLLNFAKA   80 (156)
Q Consensus         1 m~s~~f~~i~rdl~~~gd~v~i~~~~~~v~f~~~gd~~~~~i~l~~~~~~~~~~~~v~i~~~~~~~~~fs~k~~~~~~k~   80 (156)
                      |+|++|+++||||+.+||+|+|.+++++++|++.||.|+.++.+..+.      +.                        
T Consensus       138 m~s~~f~~~~~dl~~~sd~v~i~~~~~~~~f~~~gd~~~~~~~~~~~~------~l------------------------  187 (249)
T 3fds_C          138 TDESVLNVIAADVTLVGEEMRISTEEDKIKIEAGEEGKRYVAFLMKDK------PL------------------------  187 (249)
T ss_dssp             ECHHHHHHHHHHHHHHCSEEEEEEETTEEEEEEEETTEEEEEEEEETB------EE------------------------
T ss_pred             EEHHHHHHHHHHHHHhCCEEEEEEECCEEEEEEEecCcEEEEEEcCCC------Cc------------------------
Confidence            799999999999999999999999999999999999998888886542      12                        


Q ss_pred             CCCCcccccceEEEecCceeeeeehhhHHhhhh-hcCCCceEEEEeeCCCcEEEEEEeCCCeEEEEEEeecc
Q psy2363          81 APLSNQEEEAVTVEMQEPVSLNFACRYLLNFAK-AAPLSNQVCLSMSLDVPLVVEFKIDDIGHIRYYLAPKI  151 (156)
Q Consensus        81 ~~~~~~~~~~V~i~~~~~V~l~Fa~~~L~~f~K-aa~ls~~V~l~l~~~~Pl~v~f~i~~~G~l~~yLAPki  151 (156)
                                +.+++++|++.+|+++||+.|+| |+++|++|+|+|++++||+|+|.++++|+|+|||||||
T Consensus       188 ----------~~~~~~~~~~~~fsl~yL~~~~K~a~~ls~~V~i~~~~~~Pl~l~y~i~~~G~l~f~lAPri  249 (249)
T 3fds_C          188 ----------KELSIDTSASSSYSAEMFKDAVKGLRGFSAPTMVSFGENLPMKIDVEAVSGGHMIFWIAPRL  249 (249)
T ss_dssp             ----------SEEEESSCCEEEEEHHHHHHHHHTTTTCCSCEEEEECTTCCEEEEEECTTSCEEEEEECCBC
T ss_pred             ----------EEEEcCCceEEEEEHHHHHHHHhhhcccCCEEEEEecCCcCEEEEEEeCCCcEEEEEEeccC
Confidence                      23445556666777777999999 99999999999999999999999999999999999997
>3k4x_A PCNA, proliferating cell nuclear antigen; DNA replication, DNA-binding; HET: DNA; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>3pge_A SUMO-modified proliferating cell nuclear antigen; DNA replication, DNA binding protein; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3p91_A Proliferating cell nuclear antigen; DNA binding protein, DNA replication, processivity, sliding; 2.40A {Entamoeba histolytica} Back     alignment and structure
>3k4x_A PCNA, proliferating cell nuclear antigen; DNA replication, DNA-binding; HET: DNA; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B Back     alignment and structure
>3ifv_A PCNA; processivity factor, sliding clamp, halophilic, replication; 2.00A {Haloferax volcanii} PDB: 3hi8_A Back     alignment and structure
>3lx2_A DNA polymerase sliding clamp 2; PCNA, DNA processivity factor, trimer, toroidal, DNA replica DNA-binding, DNA binding protein; HET: DNA; 2.40A {Thermococcus kodakarensis} Back     alignment and structure
>3fds_D DNA polymerase sliding clamp C; protein-protein complex, DNA damage, DNA repair, DNA replica DNA-binding, DNA-directed DNA polymerase; HET: DNA 1PE PGE; 2.05A {Sulfolobus solfataricus} PDB: 2nti_E* 2io4_B* 2ix2_B* 2hik_B 2hii_B* 2izo_B* Back     alignment and structure
>1plq_A Proliferating cell nuclear antigen (PCNA); DNA-binding, nuclear protein, DNA replication, processivity; 2.30A {Saccharomyces cerevisiae} SCOP: d.131.1.2 d.131.1.2 PDB: 1plr_A 2od8_A* 1sxj_F* 3f1w_A 3v60_B 3v61_B 3v62_B* 3gpn_A 3gpm_A 3l0w_A 3l0x_A 3l10_A 3pge_B 3l0x_B Back     alignment and structure
>3a1j_C Cell cycle checkpoint protein RAD1; DNA damage, DNA repair, exonuclease, hydrolase, nuclease, nucleus, phosphoprotein, polymorphism, cytoplasm; HET: SUC; 2.50A {Homo sapiens} PDB: 3g65_B 3ggr_C Back     alignment and structure
>1u7b_A PCNA, cyclin, proliferating cell nuclear antigen; sliding clamp, DNA processing, FEN1, PIP- BOX, replication; 1.88A {Homo sapiens} SCOP: d.131.1.2 d.131.1.2 PDB: 1u76_A 1axc_A 1ul1_A 1vyj_A 1vym_A 1w60_A 2zvk_A* 2zvl_A* 2zvm_A* 3p87_A 3vkx_A* Back     alignment and structure
>2zvv_A PCNA 1, proliferating cellular nuclear antigen 1; protein-peptide complex, DNA replication, DNA-binding, nucleus, DNA binding protein; 2.00A {Arabidopsis thaliana} PDB: 2zvw_A Back     alignment and structure
>3a1j_B HHUS1, checkpoint protein HUS1; DNA damage, DNA repair, exonuclease, hydrolase, nuclease, nucleus, phosphoprotein, polymorphism, cytoplasm; HET: SUC; 2.50A {Homo sapiens} PDB: 3g65_C 3ggr_B Back     alignment and structure
>1iz5_A Proliferating cell nuclear antigen; DNA, replication, processivity, sliding clamp, DNA binding protein; 1.80A {Pyrococcus furiosus} SCOP: d.131.1.2 d.131.1.2 PDB: 3a2f_B* 1iz4_A 1ge8_A 1isq_A 3lx1_A* Back     alignment and structure
>3aiz_A DNA polymerase sliding clamp B; protein-protein complex, replication; HET: DNA; 2.80A {Sulfolobus tokodaii} PDB: 3aix_B* Back     alignment and structure
>3aiz_C DNA polymerase sliding clamp C; protein-protein complex, replication; HET: DNA; 2.80A {Sulfolobus tokodaii} PDB: 3aix_A* Back     alignment and structure
>1rwz_A DNA polymerase sliding clamp; torus, processivity factor, replication; HET: DNA; 1.80A {Archaeoglobus fulgidus} SCOP: d.131.1.2 d.131.1.2 PDB: 1rxm_A* 1rxz_A* 3p83_A* Back     alignment and structure
>2ijx_A DNA polymerase sliding clamp A; PCNA3 subunit, protein-protein interaction, PCNA123 heterotr binding protein; HET: DNA; 1.90A {Sulfolobus solfataricus} PDB: 2nti_F* 2hii_C 2hik_C 2ix2_C* Back     alignment and structure
>1ud9_A DNA polymerase sliding clamp A; DNA-binding, DNA replication, DNA binding protein; HET: DNA; 1.68A {Sulfolobus tokodaii} SCOP: d.131.1.2 d.131.1.2 Back     alignment and structure
>3a1j_A Cell cycle checkpoint control protein RAD9A; DNA damage, DNA repair, exonuclease, hydrolase, nuclease, nucleus, phosphoprotein, polymorphism, cytoplasm; HET: SUC; 2.50A {Homo sapiens} PDB: 3ggr_A Back     alignment and structure
>3g65_A Cell cycle checkpoint control protein RAD9A; PCNA, DNA binding clamp, DNA damage, DNA repair, exonuclease, hydrolase, nuclease, nucleus, phosphoprotein; 2.90A {Homo sapiens} Back     alignment and structure
>1vpk_A DNA polymerase III, beta subunit; TM0262, structural genomic center for structural genomics, JCSG, protein structure INI PSI, transferase; HET: DNA; 2.00A {Thermotoga maritima} SCOP: d.131.1.1 d.131.1.1 d.131.1.1 Back     alignment and structure
>2avt_A DNA polymerase III beta subunit; beta clamp, sliding clamp, replication, transferase; HET: DNA; 2.00A {Streptococcus pyogenes} PDB: 2awa_A* Back     alignment and structure
>3d1g_A DNA polymerase III subunit beta; chemical probe, DNA sliding clamp, DNA replication, rational drug design, antibiotic target, transferase; HET: DNA 322; 1.64A {Escherichia coli} SCOP: d.131.1.1 d.131.1.1 d.131.1.1 PDB: 1mmi_A* 1unn_A* 2pol_A* 3bep_A* 3d1e_A* 3d1f_A* 1ok7_A* 3q4j_A* 3q4k_A* 3qsb_A* 3q4l_A* 2xur_A* 1jql_A* 1jqj_A* 3f1v_A* 3pwe_A* Back     alignment and structure
>3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B Back     alignment and structure
>3pge_A SUMO-modified proliferating cell nuclear antigen; DNA replication, DNA binding protein; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3t0p_A DNA polymerase III, beta subunit; DNA clamp, structural genomics, joint center for structural JCSG, protein structure initiative; HET: DNA MSE; 2.26A {Eubacterium rectale} Back     alignment and structure
>3p91_A Proliferating cell nuclear antigen; DNA binding protein, DNA replication, processivity, sliding; 2.40A {Entamoeba histolytica} Back     alignment and structure
>3a1j_C Cell cycle checkpoint protein RAD1; DNA damage, DNA repair, exonuclease, hydrolase, nuclease, nucleus, phosphoprotein, polymorphism, cytoplasm; HET: SUC; 2.50A {Homo sapiens} PDB: 3g65_B 3ggr_C Back     alignment and structure
>3lx2_A DNA polymerase sliding clamp 2; PCNA, DNA processivity factor, trimer, toroidal, DNA replica DNA-binding, DNA binding protein; HET: DNA; 2.40A {Thermococcus kodakarensis} Back     alignment and structure
>3fds_D DNA polymerase sliding clamp C; protein-protein complex, DNA damage, DNA repair, DNA replica DNA-binding, DNA-directed DNA polymerase; HET: DNA 1PE PGE; 2.05A {Sulfolobus solfataricus} PDB: 2nti_E* 2io4_B* 2ix2_B* 2hik_B 2hii_B* 2izo_B* Back     alignment and structure
>1u7b_A PCNA, cyclin, proliferating cell nuclear antigen; sliding clamp, DNA processing, FEN1, PIP- BOX, replication; 1.88A {Homo sapiens} SCOP: d.131.1.2 d.131.1.2 PDB: 1u76_A 1axc_A 1ul1_A 1vyj_A 1vym_A 1w60_A 2zvk_A* 2zvl_A* 2zvm_A* 3p87_A 3vkx_A* Back     alignment and structure
>3p16_A DNA polymerase III subunit beta; DNA polymerase III sliding clamp, transferase; HET: DNA; 2.89A {Mycobacterium tuberculosis} PDB: 3rb9_A* Back     alignment and structure
>1plq_A Proliferating cell nuclear antigen (PCNA); DNA-binding, nuclear protein, DNA replication, processivity; 2.30A {Saccharomyces cerevisiae} SCOP: d.131.1.2 d.131.1.2 PDB: 1plr_A 2od8_A* 1sxj_F* 3f1w_A 3v60_B 3v61_B 3v62_B* 3gpn_A 3gpm_A 3l0w_A 3l0x_A 3l10_A 3pge_B 3l0x_B Back     alignment and structure
>2zvv_A PCNA 1, proliferating cellular nuclear antigen 1; protein-peptide complex, DNA replication, DNA-binding, nucleus, DNA binding protein; 2.00A {Arabidopsis thaliana} PDB: 2zvw_A Back     alignment and structure
>3fds_C DNA polymerase sliding clamp B; protein-protein complex, DNA damage, DNA repair, DNA replica DNA-binding, DNA-directed DNA polymerase; HET: DNA 1PE PGE; 2.05A {Sulfolobus solfataricus} PDB: 2io4_A* 2nti_D* 2hii_A 2hik_A 2ix2_A* 2izo_C* Back     alignment and structure
>3a1j_B HHUS1, checkpoint protein HUS1; DNA damage, DNA repair, exonuclease, hydrolase, nuclease, nucleus, phosphoprotein, polymorphism, cytoplasm; HET: SUC; 2.50A {Homo sapiens} PDB: 3g65_C 3ggr_B Back     alignment and structure
>1iz5_A Proliferating cell nuclear antigen; DNA, replication, processivity, sliding clamp, DNA binding protein; 1.80A {Pyrococcus furiosus} SCOP: d.131.1.2 d.131.1.2 PDB: 3a2f_B* 1iz4_A 1ge8_A 1isq_A 3lx1_A* Back     alignment and structure
>3aiz_C DNA polymerase sliding clamp C; protein-protein complex, replication; HET: DNA; 2.80A {Sulfolobus tokodaii} PDB: 3aix_A* Back     alignment and structure
>3aiz_A DNA polymerase sliding clamp B; protein-protein complex, replication; HET: DNA; 2.80A {Sulfolobus tokodaii} PDB: 3aix_B* Back     alignment and structure
>3a1j_A Cell cycle checkpoint control protein RAD9A; DNA damage, DNA repair, exonuclease, hydrolase, nuclease, nucleus, phosphoprotein, polymorphism, cytoplasm; HET: SUC; 2.50A {Homo sapiens} PDB: 3ggr_A Back     alignment and structure
>1ud9_A DNA polymerase sliding clamp A; DNA-binding, DNA replication, DNA binding protein; HET: DNA; 1.68A {Sulfolobus tokodaii} SCOP: d.131.1.2 d.131.1.2 Back     alignment and structure
>2ijx_A DNA polymerase sliding clamp A; PCNA3 subunit, protein-protein interaction, PCNA123 heterotr binding protein; HET: DNA; 1.90A {Sulfolobus solfataricus} PDB: 2nti_F* 2hii_C 2hik_C 2ix2_C* Back     alignment and structure
>3ifv_A PCNA; processivity factor, sliding clamp, halophilic, replication; 2.00A {Haloferax volcanii} PDB: 3hi8_A Back     alignment and structure
>1rwz_A DNA polymerase sliding clamp; torus, processivity factor, replication; HET: DNA; 1.80A {Archaeoglobus fulgidus} SCOP: d.131.1.2 d.131.1.2 PDB: 1rxm_A* 1rxz_A* 3p83_A* Back     alignment and structure
>3g65_A Cell cycle checkpoint control protein RAD9A; PCNA, DNA binding clamp, DNA damage, DNA repair, exonuclease, hydrolase, nuclease, nucleus, phosphoprotein; 2.90A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 156
d1u7ba2129 d.131.1.2 (A:127-255) Proliferating cell nuclear a 8e-37
d1plqa2132 d.131.1.2 (A:127-258) Proliferating cell nuclear a 2e-35
d1rwza2122 d.131.1.2 (A:123-244) Proliferating cell nuclear a 1e-31
d1ud9a2119 d.131.1.2 (A:127-245) Proliferating cell nuclear a 6e-30
d1iz5a2121 d.131.1.2 (A:126-246) Proliferating cell nuclear a 3e-29
>d1u7ba2 d.131.1.2 (A:127-255) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens) [TaxId: 9606]} Length = 129 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: DNA clamp
superfamily: DNA clamp
family: DNA polymerase processivity factor
domain: Proliferating cell nuclear antigen (PCNA)
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  121 bits (304), Expect = 8e-37
 Identities = 83/151 (54%), Positives = 99/151 (65%), Gaps = 34/151 (22%)

Query: 1   MPSGEFARICRDLAQFGESINISCTKEGVKFSATGDIGSANIKLAQTGNVDKEEEAVTVE 60
           MPSGEFARICRDL+  G+++ ISC K+GVKFSA+G++G+ NIKL+QT NVDK        
Sbjct: 13  MPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDK-------- 64

Query: 61  MQEPVSLNFACRYLLNFAKAAPLSNQEEEAVTVEMQEPVSLNFACRYLLNFAKAAPLSNQ 120
                                     EEEAVT+EM EPV L FA RYL  F KA PLS+ 
Sbjct: 65  --------------------------EEEAVTIEMNEPVQLTFALRYLNFFTKATPLSST 98

Query: 121 VCLSMSLDVPLVVEFKIDDIGHIRYYLAPKI 151
           V LSMS DVPLVVE+KI D+GH++YYLAPKI
Sbjct: 99  VTLSMSADVPLVVEYKIADMGHLKYYLAPKI 129
>d1plqa2 d.131.1.2 (A:127-258) Proliferating cell nuclear antigen (PCNA) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 132 Back     information, alignment and structure
>d1rwza2 d.131.1.2 (A:123-244) Proliferating cell nuclear antigen (PCNA) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 122 Back     information, alignment and structure
>d1ud9a2 d.131.1.2 (A:127-245) Proliferating cell nuclear antigen (PCNA) {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Length = 119 Back     information, alignment and structure
>d1iz5a2 d.131.1.2 (A:126-246) Proliferating cell nuclear antigen (PCNA) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 121 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query156
d1plqa2132 Proliferating cell nuclear antigen (PCNA) {Baker's 100.0
d1u7ba2129 Proliferating cell nuclear antigen (PCNA) {Human ( 99.97
d1iz5a2121 Proliferating cell nuclear antigen (PCNA) {Archaeo 99.97
d1rwza2122 Proliferating cell nuclear antigen (PCNA) {Archaeo 99.97
d1ud9a2119 Proliferating cell nuclear antigen (PCNA) {Archaeo 99.96
d1u7ba1126 Proliferating cell nuclear antigen (PCNA) {Human ( 97.5
d1rwza1122 Proliferating cell nuclear antigen (PCNA) {Archaeo 97.35
d1plqa1126 Proliferating cell nuclear antigen (PCNA) {Baker's 97.31
d1plqa2132 Proliferating cell nuclear antigen (PCNA) {Baker's 97.23
d1ud9a1119 Proliferating cell nuclear antigen (PCNA) {Archaeo 97.22
d1iz5a1119 Proliferating cell nuclear antigen (PCNA) {Archaeo 97.19
d1vpka3123 DNA polymerase III, beta subunit {Thermotoga marit 96.97
d1ok7a3122 DNA polymerase III, beta subunit {Escherichia coli 96.97
d1u7ba2129 Proliferating cell nuclear antigen (PCNA) {Human ( 96.86
d1iz5a2121 Proliferating cell nuclear antigen (PCNA) {Archaeo 96.01
d1ud9a2119 Proliferating cell nuclear antigen (PCNA) {Archaeo 95.11
d1rwza2122 Proliferating cell nuclear antigen (PCNA) {Archaeo 89.39
>d1plqa2 d.131.1.2 (A:127-258) Proliferating cell nuclear antigen (PCNA) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: DNA clamp
superfamily: DNA clamp
family: DNA polymerase processivity factor
domain: Proliferating cell nuclear antigen (PCNA)
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=100.00  E-value=9.3e-33  Score=204.45  Aligned_cols=120  Identities=38%  Similarity=0.764  Sum_probs=105.7

Q ss_pred             CCcHHHHHHHHHHhccCCeEEEEEeCCeEEEEEeecceeEEEEEeecCCCCCCCccEEEEecCceeEEeeeeecccccCC
Q psy2363           1 MPSGEFARICRDLAQFGESINISCTKEGVKFSATGDIGSANIKLAQTGNVDKEEEAVTVEMQEPVSLNFACRYLLNFAKA   80 (156)
Q Consensus         1 m~s~~f~~i~rdl~~~gd~v~i~~~~~~v~f~~~gd~~~~~i~l~~~~~~~~~~~~v~i~~~~~~~~~fs~k~~~~~~k~   80 (156)
                      |+|++|+++||||..|||+|+|.++++++.|+++||.|+.++.+......++...                         
T Consensus        13 m~S~~f~~~~kdl~~~gd~i~i~~~~~~i~f~~~gd~g~~~i~i~~~~~~~~~~~-------------------------   67 (132)
T d1plqa2          13 LPSSEFSKIVRDLSQLSDSINIMITKETIKFVADGDIGSGSVIIKPFVDMEHPET-------------------------   67 (132)
T ss_dssp             EEHHHHHHHHHHHHTTCSEEEEEEETTEEEEEEECSSCEEEEEECCBCCTTCGGG-------------------------
T ss_pred             EEHHHHHHHHHHHHhcCCeEEEEEcCCeEEEEEEcccceEEEEEeccCCcccccc-------------------------
Confidence            7899999999999999999999999999999999999999999977654333222                         


Q ss_pred             CCCCcccccceEEEecCceeeeeehhhHHhhhhhcCCCceEEEEeeCCCcEEEEEEeCCCeEEEEEEeeccCCCC
Q psy2363          81 APLSNQEEEAVTVEMQEPVSLNFACRYLLNFAKAAPLSNQVCLSMSLDVPLVVEFKIDDIGHIRYYLAPKIESDD  155 (156)
Q Consensus        81 ~~~~~~~~~~V~i~~~~~V~l~Fa~~~L~~f~Kaa~ls~~V~l~l~~~~Pl~v~f~i~~~G~l~~yLAPki~~e~  155 (156)
                               .+.++.+++++.+||++||..|+|+++||+.|+|+|++++||+++|++++ |+|+||||||+++||
T Consensus        68 ---------~~~~~~~~~~~~~ysl~yL~~~~K~~~ls~~V~i~~~~~~Pl~~~y~i~~-g~l~fyLAPkieddd  132 (132)
T d1plqa2          68 ---------SIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKS-GFLQFFLAPKFNDEE  132 (132)
T ss_dssp             ---------CBEEEESSCEEEEEEHHHHHHHGGGGGTCSEEEEEECSSSCEEEEEEETT-EEEEEEECCCSSSCC
T ss_pred             ---------ceeeecccceeeEEEHHHHHHHhCcccCCCEEEEEEeCCCCEEEEEEeCC-EEEEEEECccCCCCC
Confidence                     34455566777777777799999999999999999999999999999975 999999999999986
>d1u7ba2 d.131.1.2 (A:127-255) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iz5a2 d.131.1.2 (A:126-246) Proliferating cell nuclear antigen (PCNA) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1rwza2 d.131.1.2 (A:123-244) Proliferating cell nuclear antigen (PCNA) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ud9a2 d.131.1.2 (A:127-245) Proliferating cell nuclear antigen (PCNA) {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1u7ba1 d.131.1.2 (A:1-126) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rwza1 d.131.1.2 (A:1-122) Proliferating cell nuclear antigen (PCNA) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1plqa1 d.131.1.2 (A:1-126) Proliferating cell nuclear antigen (PCNA) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1plqa2 d.131.1.2 (A:127-258) Proliferating cell nuclear antigen (PCNA) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ud9a1 d.131.1.2 (A:1-119) Proliferating cell nuclear antigen (PCNA) {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1iz5a1 d.131.1.2 (A:2-120) Proliferating cell nuclear antigen (PCNA) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vpka3 d.131.1.1 (A:244-366) DNA polymerase III, beta subunit {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u7ba2 d.131.1.2 (A:127-255) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iz5a2 d.131.1.2 (A:126-246) Proliferating cell nuclear antigen (PCNA) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ud9a2 d.131.1.2 (A:127-245) Proliferating cell nuclear antigen (PCNA) {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1rwza2 d.131.1.2 (A:123-244) Proliferating cell nuclear antigen (PCNA) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure