Diaphorina citri psyllid: psy237


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230------
MSTPRICTVPYQYRTPKYPQNLYRTPKYPHQFNPGRNLSSAQPAAALSEPSHPQLVTEVPGPQTKALKQKLSQLQQSGSVSLFVDYQKSFGNYLVDVDGNHILDVYTQISSVPLGYNHPALLKIFDDPATVKTFVNRPALGVFPSGDWPQLLENVLLKQSGSVSLFVDYQKSFGNYLVDVDGNHILDVYTQISSVPLGYNHPALLKIFDDPATVKCSDDKTSHIPTFARTEPPDTQ
ccccccccEEEECccccccccccccccccccccccccccccccccccccccccEEcccccccHHHHHHHHHHHHHccccEEEEEEEccccccEEEcccccEEEEEcccccccccccccHHHHHHHccccccccccccccccccccccHHHHHHHHHHcccccccHHHHHHHHHHcccccccccccccHHHHHHccccccccHHHHHHcccccHHHHHccccccccccccccccccc
****RICTVPYQYRTPKYPQNLYRTPK*************************PQLVTEVPGPQTKALKQKLSQLQQSGSVSLFVDYQKSFGNYLVDVDGNHILDVYTQISSVPLGYNHPALLKIFDDPATVKTFVNRPALGVFPSGDWPQLLENVLLKQSGSVSLFVDYQKSFGNYLVDVDGNHILDVYTQISSVPLGYNHPALLKIFDDPATVKCSDDKTSHIPTFART******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTPRICTVPYQYRTPKYPQNLYRTPKYPHQFNPGRNLSSAQPAAALSEPSHPQLVTEVPGPQTKALKQKLSQLQQSGSVSLFVDYQKSFGNYLVDVDGNHILDVYTQISSVPLGYNHPALLKIFDDPATVKTFVNRPALGVFPSGDWPQLLENVLLKQSGSVSLFVDYQKSFGNYLVDVDGNHILDVYTQISSVPLGYNHPALLKIFDDPATVKCSDDKTSHIPTFARTEPPDTQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
4-aminobutyrate aminotransferase, mitochondrial Catalyzes the conversion of gamma-aminobutyrate and L-beta-aminoisobutyrate to succinate semialdehyde and methylmalonate semialdehyde, respectively. Can also convert delta-aminovalerate and beta-alanine.confidentP80147
4-aminobutyrate aminotransferase, mitochondrial Catalyzes the conversion of gamma-aminobutyrate and L-beta-aminoisobutyrate to succinate semialdehyde and methylmalonate semialdehyde, respectively. Can also convert delta-aminovalerate and beta-alanine.confidentP80404
Probable 4-aminobutyrate aminotransferase, mitochondrial confidentQ21217

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005488 [MF]bindingprobableGO:0003674
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1OHV, chain A
Confidence level:very confident
Coverage over the Query: 48-186
View the alignment between query and template
View the model in PyMOL
Template: 1OHV, chain A
Confidence level:very confident
Coverage over the Query: 169-212
View the alignment between query and template
View the model in PyMOL