Diaphorina citri psyllid: psy2386

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-
MNLTDRHCRMFHRQITRYSWLYTEMFTTQAILGNKKHCLDFNAEEHPIAFQVGDNEPKKLAKSAKIIQKWGYDEINLNCGCPSNRVQNGFFGAILMTKPLLVSDCIKAMRDSVEIDITVKHRIGIDDINSYDFVRDFVGTVSSAGCRTFIVHARNAFLKKLNPKQNRKIPILKYNFVYNLKKDFPELEIIINGGIKTKKEIDLHLNYIDGVMLGREAYKNPFLMSNFDLNYYSNLPQYKIPTRIDIINRMILYIRQQLNNNKIKNINSITRHMLGLMKNIKGSNKFKQILSKPNLLTIDNFQFFLNTLNIP
cccccHHHHHHHHHHcccEEEEEccccHHHHHcccccccccccccccEEEECccccHHHHHHHHHHHHHccccEEEcccccccHHHcccccccccccccHHHHHHHHHHHHcccccEEEEEcccccccccHHHHHHHHHHHHHccccEEEEEHHHHHHcccccccccccccccHHHHHHHHHHccccEEEEccccccHHHHHHHHHcccEEEEcHHHHcccccHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccccHHHHHHHccccccccccHHHHHHHHccc
MNLTDRHCRMFHRQITRYSWLYTEMFTTQAILGNKKHCLDFNAEEHPIAFQVGDNEPKKLAKSAKIIQKWGYDEINLNCGCPSNRVQNGFFGAILMTKPLLVSDCIKAMRDSVEIDITVKHRIGIDDINSYDFVRDFVGTVSSAGCRTFIVHARNAFLKKLNPKQNRKIPILKYNFVYNLKKDFPELEIIINGGIKTKKEIDLHLNYIDGVMLGREAYKNPFLMSNFDLNYYSNLPQYKIPTRIDIINRMILYIRQQLNNNKIKNINSITRHMLGLMKNIKGSNKFKQILSKPNLLTIDNFQFFLNTLNIP
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNLTDRHCRMFHRQITRYSWLYTEMFTTQAILGNKKHCLDFNAEEHPIAFQVGDNEPKKLAKSAKIIQKWGYDEINLNCGCPSNRVQNGFFGAILMTKPLLVSDCIKAMRDSVEIDITVKHRIGIDDINSYDFVRDFVGTVSSAGCRTFIVHARNAFLKKLNPKQNRKIPILKYNFVYNLKKDFPELEIIINGGIKTKKEIDLHLNYIDGVMLGREAYKNPFLMSNFDLNYYSNLPQYKIPTRIDIINRMILYIRQQLNNNKIKNINSITRHMLGLMKNIKGSNKFKQILSKPNLLTIDNFQFFLNTLNIP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
tRNA-dihydrouridine synthase A Catalyzes the synthesis of dihydrouridine, a modified base found in the D-loop of most tRNAs.very confidentQ9CL29
tRNA-dihydrouridine synthase A Catalyzes the synthesis of dihydrouridine, a modified base found in the D-loop of most tRNAs.very confidentQ87L85
tRNA-dihydrouridine synthase A Catalyzes the synthesis of dihydrouridine, a modified base found in the D-loop of most tRNAs.very confidentQ7VNV2

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0003674 [MF]molecular_functionprobable
GO:0008152 [BP]metabolic processprobableGO:0008150
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0009524 [CC]phragmoplastprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3B0P, chain A
Confidence level:very confident
Coverage over the Query: 1-158,169-308
View the alignment between query and template
View the model in PyMOL