Diaphorina citri psyllid: psy2389

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170--
MSDCLIFSSLFAIYAVLGHNYAEGPTAIQIFKLPSVALNTIILLLSSLSCGFAIIQAQKKYVNGVIFWLSITTLLGFFFVILELNEFIELINRNFGPWRSAFLSSFFVLVGMHGLHIIFGIIWLITLILQIKKYNLILENQRRIICLSMFWHFLDIIWIGIFTFIYLIGTLS
ccHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc
MSDCLIFSSLFAIYAVLGHNYAEGPTAIQIFKLPSVALNTIILLLSSLSCGFAIIQAQKKYVNGVIFWLSITTLLGFFFVILELNEFIELINRNFGPWRSAFLSSFFVLVGMHGLHIIFGIIWLITLILQIKKYNLILENQRRIICLSMFWHFLDIIWIGIFTFIYLIGTLS
xxxxHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxx
SSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDCLIFSSLFAIYAVLGHNYAEGPTAIQIFKLPSVALNTIILLLSSLSCGFAIIQAQKKYVNGVIFWLSITTLLGFFFVILELNEFIELINRNFGPWRSAFLSSFFVLVGMHGLHIIFGIIWLITLILQIKKYNLILENQRRIICLSMFWHFLDIIWIGIFTFIYLIGTLS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cytochrome o ubiquinol oxidase subunit 3 Cytochrome o terminal oxidase complex is the component of the aerobic respiratory chain of E.coli that predominates when cells are grown at high aeration.very confidentQ9I425
Cytochrome o ubiquinol oxidase subunit 3 Cytochrome o terminal oxidase complex is the component of the aerobic respiratory chain that predominates when cells are grown at high aeration.very confidentP0ABJ5
Cytochrome o ubiquinol oxidase subunit 3 Cytochrome o terminal oxidase complex is the component of the aerobic respiratory chain that predominates when cells are grown at high aeration.very confidentP0ABJ4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0009319 [CC]cytochrome o ubiquinol oxidase complexprobableGO:0043234, GO:0032991, GO:0016021, GO:0016020, GO:0005575, GO:0044425, GO:0031224
GO:0015453 [MF]oxidoreduction-driven active transmembrane transporter activityprobableGO:0015399, GO:0022857, GO:0003674, GO:0022804, GO:0005215
GO:0009486 [MF]cytochrome bo3 ubiquinol oxidase activityprobableGO:0003824, GO:0003674, GO:0015002, GO:0016491
GO:0009055 [MF]electron carrier activityprobableGO:0003674
GO:0015990 [BP]electron transport coupled proton transportprobableGO:0006818, GO:0015992, GO:0006812, GO:0006811, GO:0006810, GO:0015988, GO:0015672, GO:0034220, GO:0044765, GO:0044763, GO:0051179, GO:0008150, GO:0009987, GO:0051234, GO:0055085, GO:0044699
GO:0016682 [MF]oxidoreductase activity, acting on diphenols and related substances as donors, oxygen as acceptorprobableGO:0003824, GO:0016679, GO:0003674, GO:0016491
GO:0015078 [MF]hydrogen ion transmembrane transporter activityprobableGO:0022891, GO:0022890, GO:0022892, GO:0005215, GO:0008324, GO:0022857, GO:0015075, GO:0015077, GO:0003674

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1FFT, chain C
Confidence level:very confident
Coverage over the Query: 1-170
View the alignment between query and template
View the model in PyMOL