Diaphorina citri psyllid: psy2408


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------30
MNKIDTQKNKNKDIKDIKENKDIKENKGNKGKKTVATLYDSPEGQIGSVLFGGHMHWGYWDESNSKDNFAQGSDKLSRIMINKTSITKGQRFIDIGCGFGLSGIRLAKAKGCRVDGITISKFQQESAMKTAKAEGLLDKVNFLHGDALNLPFDNDSFDGGWFFESIFHMNHSAALNEARRVLKSGSILTLTDLPLLSVSKNDNKFKEYVKKNIHSNFILVEHYPDLLNKSGFELIKIDDITSHVMPLLVPKLTEATLTYKKEIYKSIPNPEKSIDNWLYLFKYMSKNLGYIIVTAKKI
cccccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccHHHHHccccCEEEECccccccccHHHHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHHccccccEEEEEccccccccccccCEEEEEEcccccccHHHHHHHHHHHcccccEEEEEEccccccccccHHHHHHHHHHcccccccHHHHHHHHHHcccEEEEEECcccccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccEEEEEEEEc
**********************************VATLYDSPEGQIGSVLFGGHMHWGYWDESNSKDNFAQGSDKLSRIMINKTSITKGQRFIDIGCGFGLSGIRLAKAKGCRVDGITISKFQQESAMKTAKAEGLLDKVNFLHGDALNLPFDNDSFDGGWFFESIFHMNHSAALNEARRVLKSGSILTLTDLPLLSVSKNDNKFKEYVKKNIHSNFILVEHYPDLLNKSGFELIKIDDITSHVMPLLVPKLTEATLTYKKEIYKSIPNPEKSIDNWLYLFKYMSKNLGYIIVTAKKI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNKIDTxxxxxxxxxxxxxxxxxxxxxGNKGKKTVATLYDSPEGQIGSVLFGGHMHWGYWDESNSKDNFAQGSDKLSRIMINKTSITKGQRFIDIGCGFGLSGIRLAKAKGCRVDGITISKFQQESAMKTAKAEGLLDKVNFLHGDALNLPFDNDSFDGGWFFESIFHMNHSAALNEARRVLKSGSILTLTDLPLLSVSKNDNKFKEYVKKNIHSNFILVEHYPDLLNKSGFELIKIDDITSHVMPLLVPKLTEATLTYKKEIYKSIPNPEKSIDNWLYLFKYMSKNLGYIIVTAKKI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044710 [BP]single-organism metabolic processprobableGO:0008150, GO:0008152
GO:0044238 [BP]primary metabolic processprobableGO:0008150, GO:0008152
GO:0044237 [BP]cellular metabolic processprobableGO:0009987, GO:0008150, GO:0008152
GO:0008168 [MF]methyltransferase activityprobableGO:0003824, GO:0016740, GO:0016741, GO:0003674
GO:0071704 [BP]organic substance metabolic processprobableGO:0008150, GO:0008152

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BUS, chain A
Confidence level:very confident
Coverage over the Query: 50-298
View the alignment between query and template
View the model in PyMOL