Diaphorina citri psyllid: psy2420


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170----
MKKFLSKDKNEEIKSESGALKIIDRKRHIFKLAQGEYIVPEKIEAVYSKSLYVHQIFVYGESLKSYIVAIVVPDVDVVKCKALENGIPGTLSVLCADPKVKQMIMEDMAAWARQDGLRNFEQVKDIYLHPDPFSVQNGLLTPNFKMQRAQLKSYFKPQIEDLYNPPNPTATKNS
ccccccccEEEECcccccCEEEEEccccHHHcccccccccHHHHHHHHccccccEEEEEEEccccEEEEEEEccHHHHHHHHHHccccccHHHHHccHHHHHHHHHHHHHHHHHccccccEEEEEEEECcccccccccccccHHHccHHHHHHHHHHHHHHHcccccccccccc
**KFLSKDKNEEIKSESGALKIIDRKRHIFKLAQGEYIVPEKIEAVYSKSLYVHQIFVYGESLKSYIVAIVVPDVDVVKCKALENGIPGTLSVLCADPKVKQMIMEDMAAWARQDGLRNFEQVKDIYLHPDPFSVQNGLLTPNFKMQRAQLKSYFKPQIED*************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKFLSKDKNEEIKSESGALKIIDRKRHIFKLAQGEYIVPEKIEAVYSKSLYVHQIFVYGESLKSYIVAIVVPDVDVVKCKALENGIPGTLSVLCADPKVKQMIMEDMAAWARQDGLRNFEQVKDIYLHPDPFSVQNGLLTPNFKMQRAQLKSYFKPQIEDLYNPPNPTATKNS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Long-chain-fatty-acid--CoA ligase 6 Activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. Plays an important role in fatty acid metabolism in brain and the acyl-CoAs produced may be utilized exclusively for the synthesis of the brain lipid.confidentQ91WC3
Long-chain-fatty-acid--CoA ligase 6 Activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. Plays an important role in fatty acid metabolism in brain and the acyl-CoAs produced may be utilized exclusively for the synthesis of the brain lipid.confidentP33124

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0010867 [BP]positive regulation of triglyceride biosynthetic processprobableGO:0009893, GO:0019222, GO:0009891, GO:0031326, GO:0031325, GO:0031323, GO:0046890, GO:0050789, GO:0090208, GO:0031328, GO:0065007, GO:0048518, GO:0045834, GO:0010866, GO:0090207, GO:0019216, GO:0009889, GO:0050794, GO:0008150, GO:0046889, GO:0080090, GO:0048522
GO:0005777 [CC]peroxisomeprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0042579, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0006793 [BP]phosphorus metabolic processprobableGO:0009987, GO:0008150, GO:0008152, GO:0044237
GO:0004467 [MF]long-chain fatty acid-CoA ligase activityprobableGO:0003824, GO:0003674, GO:0015645, GO:0016874, GO:0016877
GO:0044249 [BP]cellular biosynthetic processprobableGO:0009058, GO:0009987, GO:0008150, GO:0008152, GO:0044237
GO:0031090 [CC]organelle membraneprobableGO:0005575, GO:0016020, GO:0043227, GO:0043226, GO:0044422
GO:0008610 [BP]lipid biosynthetic processprobableGO:1901576, GO:0044710, GO:0006629, GO:0044238, GO:0071704, GO:0009058, GO:0008150, GO:0008152
GO:0001676 [BP]long-chain fatty acid metabolic processprobableGO:0044238, GO:0006631, GO:0006629, GO:0006082, GO:0009987, GO:0044710, GO:0044237, GO:0032787, GO:0071704, GO:0008150, GO:0019752, GO:0008152, GO:0043436, GO:0044255, GO:0044281
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0006641 [BP]triglyceride metabolic processprobableGO:0044238, GO:0044710, GO:0009987, GO:0006629, GO:0006639, GO:0006638, GO:0044237, GO:0071704, GO:0008150, GO:0008152, GO:0044255, GO:0046486
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0031967 [CC]organelle envelopeprobableGO:0005575, GO:0044464, GO:0005623, GO:0031975, GO:0044446, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0007405 [BP]neuroblast proliferationprobableGO:0032502, GO:0048699, GO:0048856, GO:0044707, GO:0007399, GO:0008283, GO:0009987, GO:0048869, GO:0030154, GO:0044763, GO:0007275, GO:0032501, GO:0008150, GO:0061351, GO:0048731, GO:0022008, GO:0072089, GO:0044699
GO:0015908 [BP]fatty acid transportprobableGO:0051234, GO:0015718, GO:0006869, GO:0015849, GO:0006811, GO:0006810, GO:0015711, GO:0051179, GO:0044765, GO:0008150, GO:0071702, GO:0033036, GO:0010876, GO:0006820, GO:0044699, GO:0046942
GO:0010747 [BP]positive regulation of plasma membrane long-chain fatty acid transportprobableGO:0051049, GO:0034764, GO:0034765, GO:0044070, GO:0050789, GO:0034762, GO:0034767, GO:0051050, GO:0032370, GO:0065007, GO:0043269, GO:0048518, GO:0010746, GO:2000193, GO:2000191, GO:0050794, GO:0043270, GO:0008150, GO:0032890, GO:0032892, GO:0032879, GO:0032368, GO:0048522
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3FCE, chain A
Confidence level:confident
Coverage over the Query: 3-79,96-157
View the alignment between query and template
View the model in PyMOL
Template: 3ITE, chain A
Confidence level:confident
Coverage over the Query: 3-27
View the alignment between query and template
View the model in PyMOL