Psyllid ID: psy2420

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170----
MKKFLSKDKNEEIKSESGALKIIDRKRHIFKLAQGEYIVPEKIEAVYSKSLYVHQIFVYGESLKSYIVAIVVPDVDVVKCKALENGIPGTLSVLCADPKVKQMIMEDMAAWARQDGLRNFEQVKDIYLHPDPFSVQNGLLTPNFKMQRAQLKSYFKPQIEDLYNPPNPTATKNS
ccccccccEEEEEcccccEEEEEEccccHHHccccccccHHHHHHHHHccccccEEEEEEEccccEEEEEEEccHHHHHHHHHHccccccHHHHHccHHHHHHHHHHHHHHHHHccccccEEEEEEEEEccccccccccccHHHHccHHHHHHHHHHHHHHHcccccccccccc
ccccccccHHHHcccccccEEEEEccccEEEEccccEEccHHHHHEEEccccEEEEEEEcccHHHEEEEEEcccHHHHHHHHHHccccccHHHHHccHHHHHHHHHHHHHHHHHcccccHHHEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccc
mkkflskdkneeiksesgaLKIIDRKRHIFKLaqgeyivpekiEAVYSKSLYVHQIFVYGESLKSYIVAIVVPDVDVVKCKalengipgtlsvlcadpkVKQMIMEDMAAWARQDGlrnfeqvkdiylhpdpfsvqnglltpnfKMQRAQLKSYfkpqiedlynppnptatkns
mkkflskdkneeiksesgalkiidrKRHIFKlaqgeyivpEKIEAVYSKSLYVHQIFVYGESLKSYIVAIVVPDVDVVKCKAlengipgtlsvlCADPKVKQMIMEDMAAWARQDGLRNFEQVKDIYLHPDPFSVQNGLLTPNFKMQRAQLKSYfkpqiedlynppnptatkns
MKKFLSKDKNEEIKSESGALKIIDRKRHIFKLAQGEYIVPEKIEAVYSKSLYVHQIFVYGESLKSYivaivvpdvdvvKCKALENGIPGTLSVLCADPKVKQMIMEDMAAWARQDGLRNFEQVKDIYLHPDPFSVQNGLLTPNFKMQRAQLKSYFKPQIEDLYNPPNPTATKNS
*******************LKIIDRKRHIFKLAQGEYIVPEKIEAVYSKSLYVHQIFVYGESLKSYIVAIVVPDVDVVKCKALENGIPGTLSVLCADPKVKQMIMEDMAAWARQDGLRNFEQVKDIYLHPDPFSVQNGLLTPNFKMQRAQLKSYFK******************
MKKFLSKDKNEEIKSESGALKIIDRKRHIFKLAQGEYIVPEKIEAVYSKSLYVHQIFVYGESLKSYIVAIVVPDVDVVKCKALENGIPGTLSVLCADPKVKQMIMEDMAAWARQDGLRNFEQVKDIYLHPDPFSVQNGLLTPNFKMQRAQLKSYFKPQIED*************
*************KSESGALKIIDRKRHIFKLAQGEYIVPEKIEAVYSKSLYVHQIFVYGESLKSYIVAIVVPDVDVVKCKALENGIPGTLSVLCADPKVKQMIMEDMAAWARQDGLRNFEQVKDIYLHPDPFSVQNGLLTPNFKMQRAQLKSYFKPQIEDLYNPPNPTATKNS
**KFLSKDKNEEIKSESGALKIIDRKRHIFKLAQGEYIVPEKIEAVYSKSLYVHQIFVYGESLKSYIVAIVVPDVDVVKCKALENGIPGTLSVLCADPKVKQMIMEDMAAWARQDGLRNFEQVKDIYLHPDPFSVQNGLLTPNFKMQRAQLKSYFKPQIEDLYNPPNP******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKFLSKDKNEEIKSESGALKIIDRKRHIFKLAQGEYIVPEKIEAVYSKSLYVHQIFVYGESLKSYIVAIVVPDVDVVKCKALENGIPGTLSVLCADPKVKQMIMEDMAAWARQDGLRNFEQVKDIYLHPDPFSVQNGLLTPNFKMQRAQLKSYFKPQIEDLYNPPNPTATKNS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query174 2.2.26 [Sep-21-2011]
P33124697 Long-chain-fatty-acid--Co yes N/A 0.844 0.210 0.564 2e-43
Q9UKU0697 Long-chain-fatty-acid--Co no N/A 0.850 0.212 0.560 5e-43
Q9ULC5683 Long-chain-fatty-acid--Co no N/A 0.844 0.215 0.544 9e-43
P33121698 Long-chain-fatty-acid--Co no N/A 0.850 0.212 0.547 1e-42
Q91WC3697 Long-chain-fatty-acid--Co yes N/A 0.839 0.209 0.568 2e-42
Q9JID6698 Long-chain-fatty-acid--Co no N/A 0.850 0.212 0.533 6e-42
P18163699 Long-chain-fatty-acid--Co no N/A 0.850 0.211 0.520 2e-41
Q8JZR0683 Long-chain-fatty-acid--Co no N/A 0.844 0.215 0.517 2e-41
O88813683 Long-chain-fatty-acid--Co no N/A 0.844 0.215 0.517 7e-41
P41216699 Long-chain-fatty-acid--Co no N/A 0.844 0.210 0.503 4e-40
>sp|P33124|ACSL6_RAT Long-chain-fatty-acid--CoA ligase 6 OS=Rattus norvegicus GN=Acsl6 PE=1 SV=1 Back     alignment and function desciption
 Score =  174 bits (441), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 110/147 (74%)

Query: 18  GALKIIDRKRHIFKLAQGEYIVPEKIEAVYSKSLYVHQIFVYGESLKSYIVAIVVPDVDV 77
           G LKIIDRK+HIFKLAQGEY+ PEKIE +Y +S  V QI+V+G+SLK+++V IVVPD +V
Sbjct: 548 GTLKIIDRKKHIFKLAQGEYVAPEKIENIYIRSEPVAQIYVHGDSLKAFLVGIVVPDPEV 607

Query: 78  VKCKALENGIPGTLSVLCADPKVKQMIMEDMAAWARQDGLRNFEQVKDIYLHPDPFSVQN 137
           + C A + GI G    LC   ++K+ I++DM    ++ GL +FEQVK IY+H D FSVQN
Sbjct: 608 MPCWAQKKGIEGNYQELCKSKELKKAILDDMVMLGKESGLHSFEQVKAIYIHCDMFSVQN 667

Query: 138 GLLTPNFKMQRAQLKSYFKPQIEDLYN 164
           GLLTP  K +R +L+ YFK QIE+LY+
Sbjct: 668 GLLTPTLKAKRPELREYFKKQIEELYS 694
Activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. Plays an important role in fatty acid metabolism in brain and the acyl-CoAs produced may be utilized exclusively for the synthesis of the brain lipid.
Rattus norvegicus (taxid: 10116)
EC: 6EC: .EC: 2EC: .EC: 1EC: .EC: 3
>sp|Q9UKU0|ACSL6_HUMAN Long-chain-fatty-acid--CoA ligase 6 OS=Homo sapiens GN=ACSL6 PE=2 SV=4 Back     alignment and function description
>sp|Q9ULC5|ACSL5_HUMAN Long-chain-fatty-acid--CoA ligase 5 OS=Homo sapiens GN=ACSL5 PE=1 SV=1 Back     alignment and function description
>sp|P33121|ACSL1_HUMAN Long-chain-fatty-acid--CoA ligase 1 OS=Homo sapiens GN=ACSL1 PE=1 SV=1 Back     alignment and function description
>sp|Q91WC3|ACSL6_MOUSE Long-chain-fatty-acid--CoA ligase 6 OS=Mus musculus GN=Acsl6 PE=2 SV=1 Back     alignment and function description
>sp|Q9JID6|ACSL1_CAVPO Long-chain-fatty-acid--CoA ligase 1 OS=Cavia porcellus GN=ACSL1 PE=2 SV=1 Back     alignment and function description
>sp|P18163|ACSL1_RAT Long-chain-fatty-acid--CoA ligase 1 OS=Rattus norvegicus GN=Acsl1 PE=1 SV=1 Back     alignment and function description
>sp|Q8JZR0|ACSL5_MOUSE Long-chain-fatty-acid--CoA ligase 5 OS=Mus musculus GN=Acsl5 PE=2 SV=1 Back     alignment and function description
>sp|O88813|ACSL5_RAT Long-chain-fatty-acid--CoA ligase 5 OS=Rattus norvegicus GN=Acsl5 PE=2 SV=1 Back     alignment and function description
>sp|P41216|ACSL1_MOUSE Long-chain-fatty-acid--CoA ligase 1 OS=Mus musculus GN=Acsl1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query174
48105753 657 PREDICTED: long-chain-fatty-acid--CoA li 0.844 0.223 0.748 3e-63
380021425 657 PREDICTED: long-chain-fatty-acid--CoA li 0.844 0.223 0.748 3e-63
383857835 657 PREDICTED: long-chain-fatty-acid--CoA li 0.844 0.223 0.755 8e-63
350422663 657 PREDICTED: long-chain-fatty-acid--CoA li 0.844 0.223 0.741 3e-62
340723943 619 PREDICTED: long-chain-fatty-acid--CoA li 0.844 0.237 0.741 3e-62
332026916 623 Long-chain-fatty-acid--CoA ligase 1 [Acr 0.844 0.235 0.748 1e-61
307178356 633 Long-chain-fatty-acid--CoA ligase 1 [Cam 0.844 0.232 0.748 1e-61
193624896 658 PREDICTED: long-chain-fatty-acid--CoA li 0.844 0.223 0.748 1e-61
307211960 681 Long-chain-fatty-acid--CoA ligase 1 [Har 0.844 0.215 0.748 2e-61
91088831 721 PREDICTED: similar to CG3961 CG3961-PA [ 0.850 0.205 0.736 2e-61
>gi|48105753|ref|XP_395996.1| PREDICTED: long-chain-fatty-acid--CoA ligase 1-like [Apis mellifera] Back     alignment and taxonomy information
 Score =  246 bits (628), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 110/147 (74%), Positives = 133/147 (90%)

Query: 17  SGALKIIDRKRHIFKLAQGEYIVPEKIEAVYSKSLYVHQIFVYGESLKSYIVAIVVPDVD 76
           +G LKIIDR++H FKL+QGEYIVPEKIE +Y +S YVHQ+FV+GESLKS +V IV+PDVD
Sbjct: 507 NGTLKIIDRRKHTFKLSQGEYIVPEKIENIYLRSQYVHQVFVHGESLKSCVVGIVIPDVD 566

Query: 77  VVKCKALENGIPGTLSVLCADPKVKQMIMEDMAAWARQDGLRNFEQVKDIYLHPDPFSVQ 136
           VVKC A+ENGIPGTLSVLCA+P+VKQ+IM+DM +W ++ GL++FEQVKDIYLHPDPFS+Q
Sbjct: 567 VVKCWAVENGIPGTLSVLCANPQVKQLIMDDMLSWGKEAGLKSFEQVKDIYLHPDPFSIQ 626

Query: 137 NGLLTPNFKMQRAQLKSYFKPQIEDLY 163
           NGLLTP+ KM+R QLK YFKPQIEDLY
Sbjct: 627 NGLLTPSLKMKRPQLKDYFKPQIEDLY 653

Source: Apis mellifera

Species: Apis mellifera

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|380021425|ref|XP_003694566.1| PREDICTED: long-chain-fatty-acid--CoA ligase 1-like [Apis florea] Back     alignment and taxonomy information
>gi|383857835|ref|XP_003704409.1| PREDICTED: long-chain-fatty-acid--CoA ligase 1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|350422663|ref|XP_003493242.1| PREDICTED: long-chain-fatty-acid--CoA ligase 1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340723943|ref|XP_003400346.1| PREDICTED: long-chain-fatty-acid--CoA ligase 1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|332026916|gb|EGI67017.1| Long-chain-fatty-acid--CoA ligase 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307178356|gb|EFN67105.1| Long-chain-fatty-acid--CoA ligase 1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|193624896|ref|XP_001949298.1| PREDICTED: long-chain-fatty-acid--CoA ligase 1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|307211960|gb|EFN87872.1| Long-chain-fatty-acid--CoA ligase 1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|91088831|ref|XP_970461.1| PREDICTED: similar to CG3961 CG3961-PA [Tribolium castaneum] gi|270012333|gb|EFA08781.1| hypothetical protein TcasGA2_TC006471 [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query174
FB|FBgn0036821704 CG3961 [Drosophila melanogaste 0.844 0.208 0.639 1.2e-47
UNIPROTKB|F1RJV7719 ACSL6 "Uncharacterized protein 0.850 0.205 0.527 4.4e-36
UNIPROTKB|J9P2B0697 ACSL6 "Uncharacterized protein 0.850 0.212 0.520 2.2e-35
UNIPROTKB|F1PTR5722 ACSL6 "Uncharacterized protein 0.850 0.204 0.520 2.6e-35
RGD|69403697 Acsl6 "acyl-CoA synthetase lon 0.844 0.210 0.517 2.9e-35
UNIPROTKB|G3V1S9606 ACSL6 "Acyl-CoA synthetase lon 0.850 0.244 0.513 3e-35
UNIPROTKB|E7ERD7677 ACSL6 "Long-chain-fatty-acid-- 0.850 0.218 0.513 5.5e-35
UNIPROTKB|Q9UKU0697 ACSL6 "Long-chain-fatty-acid-- 0.850 0.212 0.513 6.2e-35
UNIPROTKB|J3KPG3708 ACSL6 "Long-chain-fatty-acid-- 0.850 0.209 0.513 6.6e-35
UNIPROTKB|Q0VCZ8699 ACSL1 "Acyl-CoA synthetase lon 0.850 0.211 0.5 8e-35
FB|FBgn0036821 CG3961 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 498 (180.4 bits), Expect = 1.2e-47, P = 1.2e-47
 Identities = 94/147 (63%), Positives = 114/147 (77%)

Query:    17 SGALKIIDRKRHIFKLAQGEYIVPEKIEAVYSKSLYVHQIFVYGESLKSYXXXXXXXXXX 76
             +G L+IIDR++HIFKL+QGEYIVPEKIE +Y+ S YV+Q++VYGESLKS           
Sbjct:   554 NGTLRIIDRRKHIFKLSQGEYIVPEKIENIYTLSQYVNQVYVYGESLKSCIIAVVVPDTD 613

Query:    77 XXKCKALENGIPGTLSVLCADPKVKQMIMEDMAAWARQDGLRNFEQVKDIYLHPDPFSVQ 136
               K  A EN + GTLSVLC +  VK++IM DM  W +Q GL++FEQVKDIYLHPDPFSVQ
Sbjct:   614 VLKQWATENNVRGTLSVLCNNKNVKELIMNDMLNWGKQSGLKSFEQVKDIYLHPDPFSVQ 673

Query:   137 NGLLTPNFKMQRAQLKSYFKPQIEDLY 163
             NGLLTP FK +R QLKSYFKPQ+ED+Y
Sbjct:   674 NGLLTPTFKAKRPQLKSYFKPQLEDMY 700
GO:0004467 "long-chain fatty acid-CoA ligase activity" evidence=ISS
GO:0008152 "metabolic process" evidence=IEA
UNIPROTKB|F1RJV7 ACSL6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|J9P2B0 ACSL6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1PTR5 ACSL6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|69403 Acsl6 "acyl-CoA synthetase long-chain family member 6" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|G3V1S9 ACSL6 "Acyl-CoA synthetase long-chain family member 6, isoform CRA_c" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E7ERD7 ACSL6 "Long-chain-fatty-acid--CoA ligase 6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UKU0 ACSL6 "Long-chain-fatty-acid--CoA ligase 6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J3KPG3 ACSL6 "Long-chain-fatty-acid--CoA ligase 6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q0VCZ8 ACSL1 "Acyl-CoA synthetase long-chain family member 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q91WC3ACSL6_MOUSE6, ., 2, ., 1, ., 30.56840.83900.2094yesN/A
P33124ACSL6_RAT6, ., 2, ., 1, ., 30.56460.84480.2109yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query174
cd05927539 cd05927, LC-FACS_euk, Eukaryotic long-chain fatty 4e-74
PLN02736651 PLN02736, PLN02736, long-chain acyl-CoA synthetase 1e-62
PLN02861660 PLN02861, PLN02861, long-chain-fatty-acid-CoA liga 1e-42
PLN02614666 PLN02614, PLN02614, long-chain acyl-CoA synthetase 1e-37
PLN02430660 PLN02430, PLN02430, long-chain-fatty-acid-CoA liga 7e-37
COG1022613 COG1022, FAA1, Long-chain acyl-CoA synthetases (AM 2e-33
cd05907456 cd05907, VL_LC_FACS_like, Long-chain fatty acid Co 2e-31
PLN02387696 PLN02387, PLN02387, long-chain-fatty-acid-CoA liga 2e-25
PTZ00216700 PTZ00216, PTZ00216, acyl-CoA synthetase; Provision 2e-19
PTZ00297 1452 PTZ00297, PTZ00297, pantothenate kinase; Provision 1e-16
cd05932504 cd05932, LC_FACS_bac, Bacterial long-chain fatty a 1e-11
cd05914448 cd05914, FACL_like_3, Uncharacterized subfamily of 9e-11
pfam00501412 pfam00501, AMP-binding, AMP-binding enzyme 2e-06
PTZ00342746 PTZ00342, PTZ00342, acyl-CoA synthetase; Provision 1e-05
cd05921559 cd05921, FCS, Feruloyl-CoA synthetase (FCS) 9e-05
COG0318534 COG0318, CaiC, Acyl-CoA synthetases (AMP-forming)/ 2e-04
PRK09029458 PRK09029, PRK09029, O-succinylbenzoic acid--CoA li 2e-04
cd05933594 cd05933, ACSBG_like, Bubblegum-like very long-chai 0.001
>gnl|CDD|213293 cd05927, LC-FACS_euk, Eukaryotic long-chain fatty acid CoA synthetase (LC-FACS) Back     alignment and domain information 
 Score =  230 bits (590), Expect = 4e-74
 Identities = 76/149 (51%), Positives = 109/149 (73%), Gaps = 1/149 (0%)

Query: 16  ESGALKIIDRKRHIFKLAQGEYIVPEKIEAVYSKSLYVHQIFVYGESLKSYIVAIVVPDV 75
             G LKIIDRK+++FKL+QGEY+  EK+E +Y  S  V QI VYG+SLKS++VAIVVPD 
Sbjct: 391 PDGTLKIIDRKKNLFKLSQGEYVALEKLENIYKSSPLVDQICVYGDSLKSFLVAIVVPDE 450

Query: 76  DVVKCKALENGIP-GTLSVLCADPKVKQMIMEDMAAWARQDGLRNFEQVKDIYLHPDPFS 134
           DV++  A ENG   G    LC + K+K+ I++D+    +++GL+ FE VK I+L P+PF+
Sbjct: 451 DVLEKWAAENGGGGGDFEELCNNKKLKKAILKDLNEIGKENGLKGFEIVKAIHLTPEPFT 510

Query: 135 VQNGLLTPNFKMQRAQLKSYFKPQIEDLY 163
            +NGLLTP FK++R QLK  +K +I+++Y
Sbjct: 511 PENGLLTPTFKLKRPQLKKRYKKEIDEMY 539

The members of this family are eukaryotic fatty acid CoA synthetases that activate fatty acids with chain lengths of 12 to 20. LC-FACS catalyzes the formation of fatty acyl-CoA in a two-step reaction: the formation of a fatty acyl-AMP molecule as an intermediate, and the formation of a fatty acyl-CoA. This is a required step before free fatty acids can participate in most catabolic and anabolic reactions. Organisms tend to have multiple isoforms of LC-FACS genes with multiple splice variants. For example, nine genes are found in Arabidopsis and six genes are expressed in mammalian cells. Length = 539
>gnl|CDD|178337 PLN02736, PLN02736, long-chain acyl-CoA synthetase Back     alignment and domain information
>gnl|CDD|178452 PLN02861, PLN02861, long-chain-fatty-acid-CoA ligase Back     alignment and domain information
>gnl|CDD|166255 PLN02614, PLN02614, long-chain acyl-CoA synthetase Back     alignment and domain information
>gnl|CDD|178049 PLN02430, PLN02430, long-chain-fatty-acid-CoA ligase Back     alignment and domain information
>gnl|CDD|223953 COG1022, FAA1, Long-chain acyl-CoA synthetases (AMP-forming) [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|213275 cd05907, VL_LC_FACS_like, Long-chain fatty acid CoA synthetases and Bubblegum-like very long-chain fatty acid CoA synthetases Back     alignment and domain information
>gnl|CDD|215217 PLN02387, PLN02387, long-chain-fatty-acid-CoA ligase family protein Back     alignment and domain information
>gnl|CDD|240316 PTZ00216, PTZ00216, acyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|140318 PTZ00297, PTZ00297, pantothenate kinase; Provisional Back     alignment and domain information
>gnl|CDD|213298 cd05932, LC_FACS_bac, Bacterial long-chain fatty acid CoA synthetase (LC-FACS), including Marinobacter hydrocarbonoclasticus isoprenoid Coenzyme A synthetase Back     alignment and domain information
>gnl|CDD|213282 cd05914, FACL_like_3, Uncharacterized subfamily of fatty acid CoA ligase (FACL) Back     alignment and domain information
>gnl|CDD|215954 pfam00501, AMP-binding, AMP-binding enzyme Back     alignment and domain information
>gnl|CDD|240370 PTZ00342, PTZ00342, acyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|213288 cd05921, FCS, Feruloyl-CoA synthetase (FCS) Back     alignment and domain information
>gnl|CDD|223395 COG0318, CaiC, Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|236363 PRK09029, PRK09029, O-succinylbenzoic acid--CoA ligase; Provisional Back     alignment and domain information
>gnl|CDD|213299 cd05933, ACSBG_like, Bubblegum-like very long-chain fatty acid CoA synthetase (VL-FACS) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 174
PLN02614666 long-chain acyl-CoA synthetase 100.0
PLN02430660 long-chain-fatty-acid-CoA ligase 100.0
PLN02387696 long-chain-fatty-acid-CoA ligase family protein 100.0
PLN02861660 long-chain-fatty-acid-CoA ligase 100.0
KOG1256|consensus691 100.0
PLN02736651 long-chain acyl-CoA synthetase 100.0
KOG1180|consensus678 100.0
PTZ00216700 acyl-CoA synthetase; Provisional 100.0
PTZ00342746 acyl-CoA synthetase; Provisional 100.0
PTZ00297 1452 pantothenate kinase; Provisional 99.97
COG1022613 FAA1 Long-chain acyl-CoA synthetases (AMP-forming) 99.97
PRK12582624 acyl-CoA synthetase; Provisional 99.96
PRK08180614 feruloyl-CoA synthase; Reviewed 99.95
KOG1176|consensus537 99.94
COG0365528 Acs Acyl-coenzyme A synthetases/AMP-(fatty) acid l 99.89
COG0318534 CaiC Acyl-CoA synthetases (AMP-forming)/AMP-acid l 99.88
PRK07445452 O-succinylbenzoic acid--CoA ligase; Reviewed 99.88
KOG1177|consensus596 99.88
PTZ00237647 acetyl-CoA synthetase; Provisional 99.88
PLN03051499 acyl-activating enzyme; Provisional 99.88
TIGR01217652 ac_ac_CoA_syn acetoacetyl-CoA synthase. This enzym 99.87
PLN02860563 o-succinylbenzoate-CoA ligase 99.87
PLN02654666 acetate-CoA ligase 99.87
PRK03584655 acetoacetyl-CoA synthetase; Provisional 99.86
KOG1175|consensus626 99.86
TIGR02188625 Ac_CoA_lig_AcsA acetate--CoA ligase. This model de 99.85
TIGR02316628 propion_prpE propionate--CoA ligase. This family c 99.85
PRK00174637 acetyl-CoA synthetase; Provisional 99.84
PRK10524629 prpE propionyl-CoA synthetase; Provisional 99.84
PRK07824358 O-succinylbenzoic acid--CoA ligase; Provisional 99.84
PRK07868994 acyl-CoA synthetase; Validated 99.84
PRK09188365 serine/threonine protein kinase; Provisional 99.83
PRK07788549 acyl-CoA synthetase; Validated 99.83
PLN03102579 acyl-activating enzyme; Provisional 99.83
PLN03052728 acetate--CoA ligase; Provisional 99.83
PRK06334539 long chain fatty acid--[acyl-carrier-protein] liga 99.83
PRK07529632 AMP-binding domain protein; Validated 99.83
PRK05857540 acyl-CoA synthetase; Validated 99.83
PRK08279600 long-chain-acyl-CoA synthetase; Validated 99.82
PRK04319570 acetyl-CoA synthetase; Provisional 99.82
TIGR03443 1389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 99.82
PRK09029458 O-succinylbenzoic acid--CoA ligase; Provisional 99.82
PLN02574560 4-coumarate--CoA ligase-like 99.82
PRK05852534 acyl-CoA synthetase; Validated 99.82
PRK06060 705 acyl-CoA synthetase; Validated 99.81
PRK07638487 acyl-CoA synthetase; Validated 99.81
PRK05620576 long-chain-fatty-acid--CoA ligase; Validated 99.81
PRK08316523 acyl-CoA synthetase; Validated 99.81
PRK08043718 bifunctional acyl-[acyl carrier protein] synthetas 99.8
PRK07867529 acyl-CoA synthetase; Validated 99.8
PRK09088488 acyl-CoA synthetase; Validated 99.8
PRK07008539 long-chain-fatty-acid--CoA ligase; Validated 99.8
PRK05677562 long-chain-fatty-acid--CoA ligase; Validated 99.8
TIGR02275527 DHB_AMP_lig 2,3-dihydroxybenzoate-AMP ligase. Prot 99.8
TIGR01734502 D-ala-DACP-lig D-alanine--poly(phosphoribitol) lig 99.8
PRK06839496 acyl-CoA synthetase; Validated 99.79
PRK06155542 crotonobetaine/carnitine-CoA ligase; Provisional 99.79
PRK09274552 peptide synthase; Provisional 99.79
PRK13295547 cyclohexanecarboxylate-CoA ligase; Reviewed 99.79
PRK08314546 long-chain-fatty-acid--CoA ligase; Validated 99.79
PRK07514504 malonyl-CoA synthase; Validated 99.79
PRK07470528 acyl-CoA synthetase; Validated 99.79
PRK13390501 acyl-CoA synthetase; Provisional 99.79
PRK13382537 acyl-CoA synthetase; Provisional 99.79
PLN02246537 4-coumarate--CoA ligase 99.79
COG1021542 EntE Peptide arylation enzymes [Secondary metaboli 99.79
PRK12583558 acyl-CoA synthetase; Provisional 99.79
PRK10946536 entE enterobactin synthase subunit E; Provisional 99.79
PRK05605573 long-chain-fatty-acid--CoA ligase; Validated 99.79
PRK13388540 acyl-CoA synthetase; Provisional 99.78
PRK06145497 acyl-CoA synthetase; Validated 99.78
PRK06178567 acyl-CoA synthetase; Validated 99.78
PRK05851525 long-chain-fatty-acid--[acyl-carrier-protein] liga 99.78
PRK08276502 long-chain-fatty-acid--CoA ligase; Validated 99.78
PRK07769631 long-chain-fatty-acid--CoA ligase; Validated 99.78
TIGR03208538 cyc_hxne_CoA_lg cyclohexanecarboxylate-CoA ligase. 99.78
PLN02330546 4-coumarate--CoA ligase-like 1 99.78
PRK04813503 D-alanine--poly(phosphoribitol) ligase subunit 1; 99.78
PRK13391511 acyl-CoA synthetase; Provisional 99.77
PRK06188524 acyl-CoA synthetase; Validated 99.77
PRK07787471 acyl-CoA synthetase; Validated 99.77
PRK06018542 putative acyl-CoA synthetase; Provisional 99.77
PRK068141140 acylglycerophosphoethanolamine acyltransferase; Pr 99.77
PRK06164540 acyl-CoA synthetase; Validated 99.77
PRK03640483 O-succinylbenzoic acid--CoA ligase; Provisional 99.77
PLN02479567 acetate-CoA ligase 99.77
PRK08008517 caiC putative crotonobetaine/carnitine-CoA ligase; 99.77
PRK08308414 acyl-CoA synthetase; Validated 99.77
PRK07786542 long-chain-fatty-acid--CoA ligase; Validated 99.77
PRK07798533 acyl-CoA synthetase; Validated 99.77
TIGR03098515 ligase_PEP_1 acyl-CoA ligase (AMP-forming), exosor 99.76
PRK06087547 short chain acyl-CoA synthetase; Reviewed 99.76
PRK12492562 long-chain-fatty-acid--CoA ligase; Provisional 99.76
PRK06710563 long-chain-fatty-acid--CoA ligase; Validated 99.76
PRK12406509 long-chain-fatty-acid--CoA ligase; Provisional 99.76
PRK08315559 AMP-binding domain protein; Validated 99.75
PRK086331146 2-acyl-glycerophospho-ethanolamine acyltransferase 99.75
PRK13383516 acyl-CoA synthetase; Provisional 99.75
PRK08162545 acyl-CoA synthetase; Validated 99.75
PRK08751560 putative long-chain fatty acyl CoA ligase; Provisi 99.74
TIGR02372386 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactiv 99.74
PRK123165163 peptide synthase; Provisional 99.74
PRK12316 5163 peptide synthase; Provisional 99.74
PRK12476612 putative fatty-acid--CoA ligase; Provisional 99.74
PRK07656513 long-chain-fatty-acid--CoA ligase; Validated 99.74
PRK07059557 Long-chain-fatty-acid--CoA ligase; Validated 99.73
PRK08974560 long-chain-fatty-acid--CoA ligase; Validated 99.72
TIGR01923436 menE O-succinylbenzoate-CoA ligase. This model rep 99.72
TIGR03205541 pimA dicarboxylate--CoA ligase PimA. PimA, a membe 99.72
PRK06187521 long-chain-fatty-acid--CoA ligase; Validated 99.71
PRK12467 3956 peptide synthase; Provisional 99.71
PRK09192579 acyl-CoA synthetase; Validated 99.71
PRK12467 3956 peptide synthase; Provisional 99.7
PRK10252 1296 entF enterobactin synthase subunit F; Provisional 99.7
TIGR02262508 benz_CoA_lig benzoate-CoA ligase family. Character 99.7
PRK05850578 acyl-CoA synthetase; Validated 99.69
PRK05691 4334 peptide synthase; Validated 99.68
PRK056914334 peptide synthase; Validated 99.66
PRK07768545 long-chain-fatty-acid--CoA ligase; Validated 99.61
KOG1179|consensus649 99.48
TIGR02155422 PA_CoA_ligase phenylacetate-CoA ligase. Phenylacet 99.2
KOG1178|consensus 1032 99.18
PF1319373 AMP-binding_C: AMP-binding enzyme C-terminal domai 98.97
TIGR03335445 F390_ftsA coenzyme F390 synthetase. This enzyme, c 97.44
KOG3628|consensus1363 97.35
COG1541438 PaaK Coenzyme F390 synthetase [Coenzyme metabolism 97.19
PF1453596 AMP-binding_C_2: AMP-binding enzyme C-terminal dom 96.64
TIGR02304430 aden_form_hyp probable adenylate-forming enzyme. M 95.46
TIGR01733408 AA-adenyl-dom amino acid adenylation domain. This 91.47
>PLN02614 long-chain acyl-CoA synthetase Back     alignment and domain information 
Probab=100.00  E-value=4.6e-38  Score=276.25  Aligned_cols=166  Identities=37%  Similarity=0.715  Sum_probs=158.4

Q ss_pred             CCcccccCCceeeccCCcEEEEccCcCceecCCceeeccHHHHHHHhcCcccceEEEEeeCCCCcEEEEEEcChHHHHHH
Q psy2420           2 KKFLSKDKNEEIKSESGALKIIDRKRHIFKLAQGEYIVPEKIEAVYSKSLYVHQIFVYGESLKSYIVAIVVPDVDVVKCK   81 (174)
Q Consensus         2 ~~~~~tgd~~~~~d~~G~l~i~GR~~d~i~~s~G~~V~p~~iE~~l~~~~~V~~~~V~g~~~~~~~~a~v~~~~~~~~~~   81 (174)
                      .+||+|||. |++|+||+|+|+||+||+||+++|+||+|.+||+.|.+||.|.+|+|+|++.+++++|+|+|+.+.+..|
T Consensus       495 dGw~~TGDl-g~~d~dG~l~i~gR~kd~ik~~~G~~V~p~eIE~~l~~~p~V~~~~V~g~~~~~~l~alvv~~~~~~~~~  573 (666)
T PLN02614        495 DGWLHTGDV-GEWQPNGSMKIIDRKKNIFKLSQGEYVAVENIENIYGEVQAVDSVWVYGNSFESFLVAIANPNQQILERW  573 (666)
T ss_pred             cCCcccceE-EEEcCCCCEEEEEcchhceecCCCeeecHHHHHHHHhcCCCeeEEEEEecCCcceEEEEEeCCHHHHHHH
Confidence            479999998 9999999999999999999987899999999999999999999999999997789999999999999999


Q ss_pred             HHHcCCCCChhhhcCCHHHHHHHHHHHHHHHHhCCCCCceeeeeEEEecCCCCcCCCccCccccccHHHHHHHHHHHHHH
Q psy2420          82 ALENGIPGTLSVLCADPKVKQMIMEDMAAWARQDGLRNFEQVKDIYLHPDPFSVQNGLLTPNFKMQRAQLKSYFKPQIED  161 (174)
Q Consensus        82 ~~~~~~~~~~~~~~~~~~~~~~i~~~l~~~~~~~~l~~~~~p~~v~~~~~~~~~~~~~~T~tgKv~R~~i~~~y~~~i~~  161 (174)
                      +++.++..++.++++++++++.+.+++.+.+++.+|+.|++|++|.+++++|+++||++|||+|++|..|.++|+++|++
T Consensus       574 ~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~l~~~e~i~~~~l~~~~f~~~ng~lTpt~K~kR~~i~~~y~~~i~~  653 (666)
T PLN02614        574 AAENGVSGDYNALCQNEKAKEFILGELVKMAKEKKMKGFEIIKAIHLDPVPFDMERDLLTPTFKKKRPQLLKYYQSVIDE  653 (666)
T ss_pred             HHhcCCCcCHHHHhcCHHHHHHHHHHHHHHHHHcCCCCcceeeEEEEeCCCCCCcCCcCCHhhhhhHHHHHHHHHHHHHH
Confidence            99999887888999999999999999999976789999999999999999999999999999999999999999999999


Q ss_pred             HhCCCCC
Q psy2420         162 LYNPPNP  168 (174)
Q Consensus       162 ly~~~~~  168 (174)
                      ||+..++
T Consensus       654 ly~~~~~  660 (666)
T PLN02614        654 MYKTTNE  660 (666)
T ss_pred             HHHhhhh
Confidence            9987654

>PLN02430 long-chain-fatty-acid-CoA ligase Back     alignment and domain information
>PLN02387 long-chain-fatty-acid-CoA ligase family protein Back     alignment and domain information
>PLN02861 long-chain-fatty-acid-CoA ligase Back     alignment and domain information
>KOG1256|consensus Back     alignment and domain information
>PLN02736 long-chain acyl-CoA synthetase Back     alignment and domain information
>KOG1180|consensus Back     alignment and domain information
>PTZ00216 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PTZ00342 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PTZ00297 pantothenate kinase; Provisional Back     alignment and domain information
>COG1022 FAA1 Long-chain acyl-CoA synthetases (AMP-forming) [Lipid metabolism] Back     alignment and domain information
>PRK12582 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK08180 feruloyl-CoA synthase; Reviewed Back     alignment and domain information
>KOG1176|consensus Back     alignment and domain information
>COG0365 Acs Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases [Lipid metabolism] Back     alignment and domain information
>COG0318 CaiC Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK07445 O-succinylbenzoic acid--CoA ligase; Reviewed Back     alignment and domain information
>KOG1177|consensus Back     alignment and domain information
>PTZ00237 acetyl-CoA synthetase; Provisional Back     alignment and domain information
>PLN03051 acyl-activating enzyme; Provisional Back     alignment and domain information
>TIGR01217 ac_ac_CoA_syn acetoacetyl-CoA synthase Back     alignment and domain information
>PLN02860 o-succinylbenzoate-CoA ligase Back     alignment and domain information
>PLN02654 acetate-CoA ligase Back     alignment and domain information
>PRK03584 acetoacetyl-CoA synthetase; Provisional Back     alignment and domain information
>KOG1175|consensus Back     alignment and domain information
>TIGR02188 Ac_CoA_lig_AcsA acetate--CoA ligase Back     alignment and domain information
>TIGR02316 propion_prpE propionate--CoA ligase Back     alignment and domain information
>PRK00174 acetyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK10524 prpE propionyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK07824 O-succinylbenzoic acid--CoA ligase; Provisional Back     alignment and domain information
>PRK07868 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>PRK07788 acyl-CoA synthetase; Validated Back     alignment and domain information
>PLN03102 acyl-activating enzyme; Provisional Back     alignment and domain information
>PLN03052 acetate--CoA ligase; Provisional Back     alignment and domain information
>PRK06334 long chain fatty acid--[acyl-carrier-protein] ligase; Validated Back     alignment and domain information
>PRK07529 AMP-binding domain protein; Validated Back     alignment and domain information
>PRK05857 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK08279 long-chain-acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK04319 acetyl-CoA synthetase; Provisional Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>PRK09029 O-succinylbenzoic acid--CoA ligase; Provisional Back     alignment and domain information
>PLN02574 4-coumarate--CoA ligase-like Back     alignment and domain information
>PRK05852 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK06060 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK07638 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK05620 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK08316 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK08043 bifunctional acyl-[acyl carrier protein] synthetase/2-acylglycerophosphoethanolamine acyltransferase; Validated Back     alignment and domain information
>PRK07867 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK09088 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK07008 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK05677 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>TIGR02275 DHB_AMP_lig 2,3-dihydroxybenzoate-AMP ligase Back     alignment and domain information
>TIGR01734 D-ala-DACP-lig D-alanine--poly(phosphoribitol) ligase, subunit 1 Back     alignment and domain information
>PRK06839 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK06155 crotonobetaine/carnitine-CoA ligase; Provisional Back     alignment and domain information
>PRK09274 peptide synthase; Provisional Back     alignment and domain information
>PRK13295 cyclohexanecarboxylate-CoA ligase; Reviewed Back     alignment and domain information
>PRK08314 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK07514 malonyl-CoA synthase; Validated Back     alignment and domain information
>PRK07470 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK13390 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK13382 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PLN02246 4-coumarate--CoA ligase Back     alignment and domain information
>COG1021 EntE Peptide arylation enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK12583 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK10946 entE enterobactin synthase subunit E; Provisional Back     alignment and domain information
>PRK05605 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK13388 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK06145 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK06178 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK05851 long-chain-fatty-acid--[acyl-carrier-protein] ligase; Validated Back     alignment and domain information
>PRK08276 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK07769 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>TIGR03208 cyc_hxne_CoA_lg cyclohexanecarboxylate-CoA ligase Back     alignment and domain information
>PLN02330 4-coumarate--CoA ligase-like 1 Back     alignment and domain information
>PRK04813 D-alanine--poly(phosphoribitol) ligase subunit 1; Provisional Back     alignment and domain information
>PRK13391 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK06188 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK07787 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK06018 putative acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PRK06164 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK03640 O-succinylbenzoic acid--CoA ligase; Provisional Back     alignment and domain information
>PLN02479 acetate-CoA ligase Back     alignment and domain information
>PRK08008 caiC putative crotonobetaine/carnitine-CoA ligase; Validated Back     alignment and domain information
>PRK08308 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK07786 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK07798 acyl-CoA synthetase; Validated Back     alignment and domain information
>TIGR03098 ligase_PEP_1 acyl-CoA ligase (AMP-forming), exosortase system type 1 associated Back     alignment and domain information
>PRK06087 short chain acyl-CoA synthetase; Reviewed Back     alignment and domain information
>PRK12492 long-chain-fatty-acid--CoA ligase; Provisional Back     alignment and domain information
>PRK06710 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK12406 long-chain-fatty-acid--CoA ligase; Provisional Back     alignment and domain information
>PRK08315 AMP-binding domain protein; Validated Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>PRK13383 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK08162 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK08751 putative long-chain fatty acyl CoA ligase; Provisional Back     alignment and domain information
>TIGR02372 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactive yellow protein activation family Back     alignment and domain information
>PRK12316 peptide synthase; Provisional Back     alignment and domain information
>PRK12316 peptide synthase; Provisional Back     alignment and domain information
>PRK12476 putative fatty-acid--CoA ligase; Provisional Back     alignment and domain information
>PRK07656 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK07059 Long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK08974 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>TIGR01923 menE O-succinylbenzoate-CoA ligase Back     alignment and domain information
>TIGR03205 pimA dicarboxylate--CoA ligase PimA Back     alignment and domain information
>PRK06187 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK12467 peptide synthase; Provisional Back     alignment and domain information
>PRK09192 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK12467 peptide synthase; Provisional Back     alignment and domain information
>PRK10252 entF enterobactin synthase subunit F; Provisional Back     alignment and domain information
>TIGR02262 benz_CoA_lig benzoate-CoA ligase family Back     alignment and domain information
>PRK05850 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK05691 peptide synthase; Validated Back     alignment and domain information
>PRK05691 peptide synthase; Validated Back     alignment and domain information
>PRK07768 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>KOG1179|consensus Back     alignment and domain information
>TIGR02155 PA_CoA_ligase phenylacetate-CoA ligase Back     alignment and domain information
>KOG1178|consensus Back     alignment and domain information
>PF13193 AMP-binding_C: AMP-binding enzyme C-terminal domain; PDB: 3L8C_B 2VSQ_A 3R44_A 3RG2_B 3A9U_A 3A9V_A 3NI2_A 1V26_B 1ULT_B 1V25_B Back     alignment and domain information
>TIGR03335 F390_ftsA coenzyme F390 synthetase Back     alignment and domain information
>KOG3628|consensus Back     alignment and domain information
>COG1541 PaaK Coenzyme F390 synthetase [Coenzyme metabolism] Back     alignment and domain information
>PF14535 AMP-binding_C_2: AMP-binding enzyme C-terminal domain; PDB: 2Y27_A 2Y4N_A 3QOV_B 3S89_D 3LAX_A 2Y4O_B Back     alignment and domain information
>TIGR02304 aden_form_hyp probable adenylate-forming enzyme Back     alignment and domain information
>TIGR01733 AA-adenyl-dom amino acid adenylation domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query174
1mdb_A539 2,3-dihydroxybenzoate-AMP ligase; adenylation doma 99.93
1t5h_X504 4-chlorobenzoyl COA ligase; adenylate-forming coen 99.9
2d1s_A548 Luciferase, luciferin 4-monooxygenase; alpha/beta, 99.89
1pg4_A652 Acetyl-COA synthetase; AMP-forming, adenylate-form 99.89
3etc_A580 AMP-binding protein; adenylate-forming acyl-COA sy 99.89
4fuq_A503 Malonyl COA synthetase; ANL superfamily, methylma 99.89
3r44_A517 Fatty acyl COA synthetase FADD13 (fatty-acyl-COA s 99.89
3ni2_A536 4-coumarate:COA ligase; 4CL, phenylpropanoid biosy 99.89
1ry2_A663 Acetyl-coenzyme A synthetase 1, acyl-activating en 99.88
3fce_A512 D-alanine--poly(phosphoribitol) ligase subunit 1; 99.88
3l8c_A521 D-alanine--poly(phosphoribitol) ligase subunit 1; 99.88
4gs5_A358 Acyl-COA synthetase (AMP-forming)/AMP-acid ligase 99.88
3c5e_A570 Acyl-coenzyme A synthetase ACSM2A, mitochondrial; 99.88
3g7s_A549 Long-chain-fatty-acid--COA ligase (FADD-1); protei 99.87
3e7w_A511 D-alanine--poly(phosphoribitol) ligase subunit 1; 99.87
3ipl_A501 2-succinylbenzoate--COA ligase; structural genomic 99.87
1v25_A541 Long-chain-fatty-acid-COA synthetase; ligase, stru 99.87
3rg2_A617 Enterobactin synthase component E (ENTE), 2,3-DIH 99.86
1amu_A563 GRSA, gramicidin synthetase 1; peptide synthetase, 99.86
3o83_A544 Peptide arylation enzyme; ligase, adenylation of 2 99.86
4gr5_A570 Non-ribosomal peptide synthetase; MBTH-like domain 99.85
3nyq_A505 Malonyl-COA ligase; A/B topology ababa sandwich be 99.85
2v7b_A529 Benzoate-coenzyme A ligase; benzoate oxidation, be 99.85
3ivr_A509 Putative long-chain-fatty-acid COA ligase; structu 99.85
3tsy_A 979 Fusion protein 4-coumarate--COA ligase 1, resvera 99.84
4dg8_A620 PA1221; ANL superfamily, adenylation domain, pepti 99.83
3rix_A550 Luciferase, luciferin 4-monooxygenase; oxidoreduct 99.83
3ite_A562 SIDN siderophore synthetase; ligase, non-ribosomal 99.81
3gqw_A576 Fatty acid AMP ligase; FAAL, E. coli, ATP-dependen 99.81
2vsq_A 1304 Surfactin synthetase subunit 3; ligase, peptidyl c 99.79
3kxw_A590 Saframycin MX1 synthetase B; fatty acid AMP ligase 99.74
2y4o_A443 Phenylacetate-coenzyme A ligase; phenylacetic acid 99.69
3qov_A436 Phenylacetate-coenzyme A ligase; acetyl-COA synthe 99.67
2y27_A437 Phenylacetate-coenzyme A ligase; phenylacetic acid 99.65
3lax_A109 Phenylacetate-coenzyme A ligase; structural genomi 99.43
3gxs_A109 Phenylacetate-coenzyme A ligase; APC62324.1, struc 99.35
4b2g_A609 GH3-1 auxin conjugating enzyme; signaling protein, 95.03
4eql_A581 4-substituted benzoates-glutamate ligase GH3.12; f 94.8
4epl_A581 Jasmonic acid-amido synthetase JAR1; ANL adenylati 92.58
>1mdb_A 2,3-dihydroxybenzoate-AMP ligase; adenylation domain, peptide synthetase, antibiotic biosynthesis, siderophore formation; HET: AMP DBH; 2.15A {Bacillus subtilis} SCOP: e.23.1.1 PDB: 1md9_A* 1mdf_A Back     alignment and structure
Probab=99.93  E-value=9.1e-26  Score=192.43  Aligned_cols=130  Identities=13%  Similarity=0.169  Sum_probs=107.9

Q ss_pred             CCcccccCCceeeccCCcEEEEccCcCceecCCceeeccHHHHHHHhcCcccceEEEEeeCCC---CcEEEEEEcChHHH
Q psy2420           2 KKFLSKDKNEEIKSESGALKIIDRKRHIFKLAQGEYIVPEKIEAVYSKSLYVHQIFVYGESLK---SYIVAIVVPDVDVV   78 (174)
Q Consensus         2 ~~~~~tgd~~~~~d~~G~l~i~GR~~d~i~~s~G~~V~p~~iE~~l~~~~~V~~~~V~g~~~~---~~~~a~v~~~~~~~   78 (174)
                      .+||+|||. |++|+||+|+|+||+||+||. +|++|+|.+||+.|.+||.|.+|+|+|.++.   ..++|+|++.....
T Consensus       406 ~g~~~TGDl-g~~~~dG~l~~~GR~dd~ik~-~G~~v~p~eIE~~l~~~p~V~~a~vv~~~~~~~g~~~~a~vv~~~~~~  483 (539)
T 1mdb_A          406 DGFYRTGDI-VRLTRDGYIVVEGRAKDQINR-GGEKVAAEEVENHLLAHPAVHDAAMVSMPDQFLGERSCVFIIPRDEAP  483 (539)
T ss_dssp             TSCEEEEEE-EEECTTSCEEEEEEGGGCEEC-SSCEECHHHHHHHHTTSTTEEEEEEEEEEETTTEEEEEEEEEESSSCC
T ss_pred             CCCeecCce-EEECCCCcEEEeccccceEEE-CCEEECHHHHHHHHHhCCCcceEEEEeccccccCceEEEEEEECCCCC
Confidence            479999998 999999999999999999996 9999999999999999999999999997644   36788888753210


Q ss_pred             HHHHHHcCCCCChhhhcCCHHHHHHHHHHHHHHHHhCCCCCceeeeeEEEecCCCCcCCCccCccccccHHHHHHHHHHH
Q psy2420          79 KCKALENGIPGTLSVLCADPKVKQMIMEDMAAWARQDGLRNFEQVKDIYLHPDPFSVQNGLLTPNFKMQRAQLKSYFKPQ  158 (174)
Q Consensus        79 ~~~~~~~~~~~~~~~~~~~~~~~~~i~~~l~~~~~~~~l~~~~~p~~v~~~~~~~~~~~~~~T~tgKv~R~~i~~~y~~~  158 (174)
                                        +       .+++.+++++..|+.|++|+.|+++++.+      +|++||++|+.+++.|.+.
T Consensus       484 ------------------~-------~~~l~~~l~~~~L~~~~~P~~i~~v~~lP------~t~~GKi~r~~L~~~~~~~  532 (539)
T 1mdb_A          484 ------------------K-------AAELKAFLRERGLAAYKIPDRVEFVESFP------QTGVGKVSKKALREAISEK  532 (539)
T ss_dssp             ------------------C-------HHHHHHHHHHTTCCGGGSCSEEEECSSCC------BCTTSCBCHHHHHHHHHHH
T ss_pred             ------------------C-------HHHHHHHHHhCCCCcccCCCEEEEeccCC------CCCCcCEeHHHHHHHHHHH
Confidence                              0       03444444333599999999999987654      6999999999999999999


Q ss_pred             HHHHhC
Q psy2420         159 IEDLYN  164 (174)
Q Consensus       159 i~~ly~  164 (174)
                      |+++|+
T Consensus       533 i~~~y~  538 (539)
T 1mdb_A          533 LLAGFK  538 (539)
T ss_dssp             HHTC--
T ss_pred             Hhcccc
Confidence            999997
>1t5h_X 4-chlorobenzoyl COA ligase; adenylate-forming coenzyme A ligase domain alternation confo change; 2.00A {Alcaligenes SP} SCOP: e.23.1.1 PDB: 1t5d_X 3cw9_A* 3cw8_X* 2qvz_X* 2qw0_X* 3dlp_X* 2qvx_X* 2qvy_X* Back     alignment and structure
>2d1s_A Luciferase, luciferin 4-monooxygenase; alpha/beta, beta barrel, alpha+beta, riken structural genomics/proteomics initiative, RSGI; HET: SLU; 1.30A {Luciola cruciata} PDB: 2d1q_A* 2d1r_A* 2d1t_A* Back     alignment and structure
>1pg4_A Acetyl-COA synthetase; AMP-forming, adenylate-forming, thioester-forming, ligase; HET: COA PRX; 1.75A {Salmonella enterica} SCOP: e.23.1.1 PDB: 1pg3_A* 2p2f_A* 2p2b_A* 2p2q_A* 2p2j_A* 2p20_A* 2p2m_A* Back     alignment and structure
>3etc_A AMP-binding protein; adenylate-forming acyl-COA synthetase ligase, ligase; HET: PGE 1PE EPE; 2.10A {Methanosarcina acetivorans} Back     alignment and structure
>4fuq_A Malonyl COA synthetase; ANL superfamily, methylma malonate, ligase; HET: MSE; 1.70A {Rhodopseudomonas palustris} PDB: 4fut_A* 4gxr_A* 4gxq_A* Back     alignment and structure
>3r44_A Fatty acyl COA synthetase FADD13 (fatty-acyl-COA synthetase); ligase; HET: HIS; 1.80A {Mycobacterium tuberculosis} PDB: 3t5c_A 3t5b_A Back     alignment and structure
>3ni2_A 4-coumarate:COA ligase; 4CL, phenylpropanoid biosynthesis; HET: AYL EPE; 1.90A {Populus tomentosa} PDB: 3a9v_A* 3a9u_A* Back     alignment and structure
>1ry2_A Acetyl-coenzyme A synthetase 1, acyl-activating enzyme 1; AMP forming, related to firefly luciferase, ligase; HET: AMP; 2.30A {Saccharomyces cerevisiae} SCOP: e.23.1.1 Back     alignment and structure
>3fce_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, AMP-forming domain, adenylation, D-alanine protein ligase, ATP complex; HET: ATP; 1.90A {Bacillus cereus} PDB: 3fcc_A* 3dhv_A* Back     alignment and structure
>3l8c_A D-alanine--poly(phosphoribitol) ligase subunit 1; structural genomics, DLTA, ATP-binding, cytoplasm, nucleotide-binding; 2.41A {Streptococcus pyogenes serotype M6} PDB: 3lgx_A* Back     alignment and structure
>4gs5_A Acyl-COA synthetase (AMP-forming)/AMP-acid ligase protein; structural genomics, PSI-biology; 2.02A {Dyadobacter fermentans} Back     alignment and structure
>3c5e_A Acyl-coenzyme A synthetase ACSM2A, mitochondrial; middle-chain acyl-COA synthetase, xenobiotic/medium-chain FA COA ligase; HET: ATP; 1.60A {Homo sapiens} PDB: 2vze_A 3b7w_A* 3day_A* 3eq6_A* 3eyn_A* 3gpc_A* 2wd9_A* Back     alignment and structure
>3g7s_A Long-chain-fatty-acid--COA ligase (FADD-1); protein structure initiative, PSI-II, NYSGXRC, 11193J, structural genomics; 2.15A {Archaeoglobus fulgidus dsm 4304} Back     alignment and structure
>3e7w_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, non-ribosomal peptide synthetase, NRPS, adenylation domain, D-alanylation; HET: AMP; 2.28A {Bacillus subtilis} PDB: 3e7x_A* Back     alignment and structure
>3ipl_A 2-succinylbenzoate--COA ligase; structural genomics, acyl-protein synthetase, PSI-2, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>1v25_A Long-chain-fatty-acid-COA synthetase; ligase, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.30A {Thermus thermophilus} SCOP: e.23.1.1 PDB: 1ult_A* 1v26_A* Back     alignment and structure
>3rg2_A Enterobactin synthase component E (ENTE), 2,3-DIH dihydroxybenzoate synthetase, isochroismatase...; adenylate-forming enzymes, ANL superfamily; HET: SVS PNS; 3.10A {Escherichia coli} Back     alignment and structure
>1amu_A GRSA, gramicidin synthetase 1; peptide synthetase, adenylate forming; HET: PHE AMP; 1.90A {Brevibacillus brevis} SCOP: e.23.1.1 Back     alignment and structure
>3o83_A Peptide arylation enzyme; ligase, adenylation of 2,3-dihydroxybenzoate and transfer to pantetheine cofactor of BASF; HET: IXN; 1.90A {Acinetobacter baumannii} SCOP: e.23.1.0 PDB: 3o82_A* 3o84_A* 3u16_A* 3u17_A* Back     alignment and structure
>4gr5_A Non-ribosomal peptide synthetase; MBTH-like domain, adenylation domain, ligase, rossmann fold, binding; HET: APC TLA; 1.92A {Streptomyces lydicus} PDB: 4gr4_A Back     alignment and structure
>3nyq_A Malonyl-COA ligase; A/B topology ababa sandwich beta-barrel adenylate-forming EN fold; HET: MCA AMP; 1.43A {Streptomyces coelicolor} PDB: 3nyr_A* Back     alignment and structure
>2v7b_A Benzoate-coenzyme A ligase; benzoate oxidation, benzoate COA ligase; 1.84A {Burkholderia xenovorans} Back     alignment and structure
>3ivr_A Putative long-chain-fatty-acid COA ligase; structural genomics, PSI-2, protein S initiative, fatty acid synthesis; HET: GOL; 2.00A {Rhodopseudomonas palustris} SCOP: e.23.1.0 Back     alignment and structure
>3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana} Back     alignment and structure
>4dg8_A PA1221; ANL superfamily, adenylation domain, peptidyl carrier protei ribosomal peptide synthetase, NRPS, valine adenylation, LIG; HET: AMP; 2.15A {Pseudomonas aeruginosa} PDB: 4dg9_A* Back     alignment and structure
>3rix_A Luciferase, luciferin 4-monooxygenase; oxidoreductase, photoprotein, luminescence, aspulvinone, natural product extracts; HET: 923; 1.70A {Photinus pyralis} SCOP: e.23.1.1 PDB: 1ba3_A 1lci_A* 4e5d_A* 3ies_A* 3iep_A* 3ier_A* 4g36_A* 4g37_A* 3qya_A Back     alignment and structure
>3ite_A SIDN siderophore synthetase; ligase, non-ribosomal peptide synthesis, NRPS, sidna3, fungal, endophyte; HET: MSE; 2.00A {Neotyphodium lolii} Back     alignment and structure
>2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} Back     alignment and structure
>3kxw_A Saframycin MX1 synthetase B; fatty acid AMP ligase, SGX, acyl adenylate, structural genom 2, protein structure initiative; HET: 1ZZ; 1.85A {Legionella pneumophila subsp} PDB: 3lnv_A* Back     alignment and structure
>2y4o_A Phenylacetate-coenzyme A ligase; phenylacetic acid degradation pathway; HET: DLL; 1.90A {Burkholderia cenocepacia} Back     alignment and structure
>3qov_A Phenylacetate-coenzyme A ligase; acetyl-COA synthetase-like, structural genomics, joint cente structural genomics, JCSG; HET: MSE ADP COA; 2.20A {Bacteroides thetaiotaomicron} PDB: 3s89_A* Back     alignment and structure
>2y27_A Phenylacetate-coenzyme A ligase; phenylacetic acid degradation pathway; HET: MSE PG4 ATP; 1.60A {Burkholderia cenocepacia} PDB: 2y4n_A* Back     alignment and structure
>3lax_A Phenylacetate-coenzyme A ligase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 1.43A {Bacteroides vulgatus} Back     alignment and structure
>4b2g_A GH3-1 auxin conjugating enzyme; signaling protein, ignaling protein, adenylate, amino acid conjugation, plant growth; HET: V1N; 2.40A {Vitis vinifera} Back     alignment and structure
>4eql_A 4-substituted benzoates-glutamate ligase GH3.12; firefly luciferase family, acyl adenylase, amino acid conjug ligase; HET: AMP SAL; 1.80A {Arabidopsis thaliana} PDB: 4epm_A* 4eq4_A* 4ewv_A* Back     alignment and structure
>4epl_A Jasmonic acid-amido synthetase JAR1; ANL adenylating enzyme, acyl acid-amido synthetase, adenylat ligase; HET: JAI; 2.01A {Arabidopsis thaliana} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 174
d3cw9a1503 e.23.1.1 (A:1-503) 4-chlorobenzoyl CoA ligase {Alc 5e-08
d1ry2a_640 e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast 1e-07
d1v25a_534 e.23.1.1 (A:) Long chain fatty acid-CoA ligase TT0 4e-07
d1amua_514 e.23.1.1 (A:) Phenylalanine activating domain of g 4e-07
d1pg4a_643 e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella en 5e-07
d1mdba_536 e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {B 3e-06
d1lcia_541 e.23.1.1 (A:) Luciferase {Firefly (Photinus pyrali 4e-06
>d3cw9a1 e.23.1.1 (A:1-503) 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId: 512]} Length = 503 Back     information, alignment and structure

class: Multi-domain proteins (alpha and beta)
fold: Acetyl-CoA synthetase-like
superfamily: Acetyl-CoA synthetase-like
family: Acetyl-CoA synthetase-like
domain: 4-chlorobenzoyl CoA ligase
species: Alcaligenes sp. [TaxId: 512]

 Score = 49.3 bits (116), Expect = 5e-08
 Identities = 29/141 (20%), Positives = 49/141 (34%), Gaps = 36/141 (25%)

Query: 16  ESGALKIIDRKRHIFKLAQGEYIVPEKIEAVYSKSLYVHQIFVYG---ESLKSYIVAIVV 72
             G ++I+ R   +     GE I P +IE V   +  V ++ V G   +     + A VV
Sbjct: 391 PEGTVRILGRVDDMIIS-GGENIHPSEIERVLGTAPGVTEVVVIGLADQRWGQSVTACVV 449

Query: 73  PDVDVVKCKALENGIPGTLSVLCADPKVKQMIMEDMAAWARQDGLRNFEQVKDIYLHPD- 131
           P +              TLS             + +  + R   L +F++ K  ++    
Sbjct: 450 PRLG------------ETLSA------------DALDTFCRSSELADFKRPKRYFILDQL 485

Query: 132 PFSVQNGLLTPNFKMQRAQLK 152
           P            K+ R QL 
Sbjct: 486 P-------KNALNKVLRRQLV 499
>d1ry2a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 640 Back     information, alignment and structure
>d1v25a_ e.23.1.1 (A:) Long chain fatty acid-CoA ligase TT0168 {Thermus thermophilus [TaxId: 274]} Length = 534 Back     information, alignment and structure
>d1amua_ e.23.1.1 (A:) Phenylalanine activating domain of gramicidin synthetase 1 {Bacillus brevis [TaxId: 1393]} Length = 514 Back     information, alignment and structure
>d1pg4a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella enterica [TaxId: 28901]} Length = 643 Back     information, alignment and structure
>d1mdba_ e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtilis [TaxId: 1423]} Length = 536 Back     information, alignment and structure
>d1lcia_ e.23.1.1 (A:) Luciferase {Firefly (Photinus pyralis) [TaxId: 7054]} Length = 541 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query174
d1ry2a_640 Acetyl-CoA synthetase {Baker's yeast (Saccharomyce 99.92
d3cw9a1503 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId 99.91
d1mdba_536 Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtil 99.91
d1pg4a_643 Acetyl-CoA synthetase {Salmonella enterica [TaxId: 99.9
d1amua_514 Phenylalanine activating domain of gramicidin synt 99.88
d1v25a_534 Long chain fatty acid-CoA ligase TT0168 {Thermus t 99.86
d1lcia_541 Luciferase {Firefly (Photinus pyralis) [TaxId: 705 99.86
>d1ry2a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Multi-domain proteins (alpha and beta)
fold: Acetyl-CoA synthetase-like
superfamily: Acetyl-CoA synthetase-like
family: Acetyl-CoA synthetase-like
domain: Acetyl-CoA synthetase
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.92  E-value=3.8e-26  Score=195.79  Aligned_cols=138  Identities=20%  Similarity=0.164  Sum_probs=103.1

Q ss_pred             CcccccCCceeeccCCcEEEEccCcCceecCCceeeccHHHHHHHhcCcccceEEEEeeCCC---CcEEEEEEcChHHHH
Q psy2420           3 KFLSKDKNEEIKSESGALKIIDRKRHIFKLAQGEYIVPEKIEAVYSKSLYVHQIFVYGESLK---SYIVAIVVPDVDVVK   79 (174)
Q Consensus         3 ~~~~tgd~~~~~d~~G~l~i~GR~~d~i~~s~G~~V~p~~iE~~l~~~~~V~~~~V~g~~~~---~~~~a~v~~~~~~~~   79 (174)
                      +||+|||. |++|++|+|+|+||.||+||+ +|++|+|.+||++|.+||.|.+|+|+|.++.   ..++|+|++.+....
T Consensus       480 gw~~TGDl-g~~d~dG~l~i~GR~dd~Ik~-~G~~I~p~eIE~~l~~~p~V~~a~Vvg~~d~~~ge~~~a~Vv~~~~~~~  557 (640)
T d1ry2a_         480 GYYFTGDG-AAKDKDGYIWILGRVDDVVNV-SGHRLSTAEIEAAIIEDPIVAECAVVGFNDDLTGQAVAAFVVLKNKSSW  557 (640)
T ss_dssp             TSEEEEEE-EEECTTCCEEECSCTTSCBCS-SSCCBCHHHHHHHHHSSTTEEEEEEECCCCCTTSCCCEEEEEEC-----
T ss_pred             CeEEcCCc-eeECCCCCEEEEEcCCCEEEE-CCEEECHHHHHHHHHhCCCccEEEEEEEECCCCCeEEEEEEEEcCCCCc
Confidence            79999998 999999999999999999997 8999999999999999999999999997653   468999998775432


Q ss_pred             HHHHHcCCCCChhhhcCCHHHHHHHHHHHHHHHHhCCCCCceeeeeEEEecCCCCcCCCccCccccccHHHHHHHHHHHH
Q psy2420          80 CKALENGIPGTLSVLCADPKVKQMIMEDMAAWARQDGLRNFEQVKDIYLHPDPFSVQNGLLTPNFKMQRAQLKSYFKPQI  159 (174)
Q Consensus        80 ~~~~~~~~~~~~~~~~~~~~~~~~i~~~l~~~~~~~~l~~~~~p~~v~~~~~~~~~~~~~~T~tgKv~R~~i~~~y~~~i  159 (174)
                      ..+.              .+..+.+.+++.+.+ +.+|++|++|+.|+++++.+      +|++||++|+.+++.++.+.
T Consensus       558 ~~~~--------------~~~~~~l~~~l~~~~-~~~L~~~~~P~~i~~v~~lP------~T~sGKi~R~~Lr~~~~~~~  616 (640)
T d1ry2a_         558 STAT--------------DDELQDIKKHLVFTV-RKDIGPFAAPKLIILVDDLP------KTRSGKIMRRILRKILAGES  616 (640)
T ss_dssp             ---------------------CCSHHHHHHHHH-HHHTCTTTSCSEEEECSCCC------BCTTSCBCHHHHHHSCC---
T ss_pred             cccc--------------hHHHHHHHHHHHHHH-HhhCCCCCCceEEEEeCCCC------CCCCcCccHHHHHHHHhCCc
Confidence            1110              011112334444444 46799999999999998754      69999999999999988776


Q ss_pred             HHHh
Q psy2420         160 EDLY  163 (174)
Q Consensus       160 ~~ly  163 (174)
                      +++.
T Consensus       617 ~~~~  620 (640)
T d1ry2a_         617 DQLG  620 (640)
T ss_dssp             ----
T ss_pred             cccC
Confidence            6554
>d3cw9a1 e.23.1.1 (A:1-503) 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d1mdba_ e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1pg4a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d1amua_ e.23.1.1 (A:) Phenylalanine activating domain of gramicidin synthetase 1 {Bacillus brevis [TaxId: 1393]} Back     information, alignment and structure
>d1v25a_ e.23.1.1 (A:) Long chain fatty acid-CoA ligase TT0168 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lcia_ e.23.1.1 (A:) Luciferase {Firefly (Photinus pyralis) [TaxId: 7054]} Back     information, alignment and structure