Diaphorina citri psyllid: psy2429


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MKSPYTYKLFLLPSHVEPALIAKSNIILDVKPWGDDTDMKEMEKQVRAIQMDGLLWGASKLAPLAYGINKLQISCVVEDDLVSVDALQESIQDIEDYVSLVFLKCVPN
ccccccHHHHcccccccccccCEEEEEEEEccccccccHHHHHHHHcEEEcccEEEcccccccccCEEEEEEEEEEEEcccccHHHHHHHHHHccccEEEEEEEEccc
****YTYKLFLLPSHVEPALIAKSNIILDVKPWGDDTDMKEMEKQVRAIQMDGLLWGASKLAPLAYGINKLQISCVVEDDLVSVDALQESIQDIEDYVSLVFLKCVP*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKSPYTYKLFLLPSHVEPALIAKSNIILDVKPWGDDTDMKEMEKQVRAIQMDGLLWGASKLAPLAYGINKLQISCVVEDDLVSVDALQESIQDIEDYVSLVFLKCVPN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Elongation factor 1-delta EF-1-beta and EF-1-delta stimulate the exchange of GDP bound to EF-1-alpha to GTP.confidentP53787
Elongation factor 1-beta EF-1-beta and EF-1-delta stimulate the exchange of GDP bound to EF-1-alpha to GTP.confidentO74173
Probable elongation factor 1-beta/1-delta 2 EF-1-beta and EF-1-delta stimulate the exchange of GDP bound to EF-1-alpha to GTP.confidentQ9U2H9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005811 [CC]lipid particleprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0007165 [BP]signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0048518 [BP]positive regulation of biological processprobableGO:0008150, GO:0065007, GO:0050789
GO:0030041 [BP]actin filament polymerizationprobableGO:0022607, GO:0070271, GO:0043933, GO:0030036, GO:0034622, GO:0071840, GO:0071822, GO:0016043, GO:0065003, GO:0044699, GO:0009987, GO:0030029, GO:0007015, GO:0006461, GO:0008154, GO:0044763, GO:0043623, GO:0006996, GO:0051258, GO:0007010, GO:0044085, GO:0008150
GO:0005085 [MF]guanyl-nucleotide exchange factor activityprobableGO:0030695, GO:0030234, GO:0060589, GO:0003674
GO:0005853 [CC]eukaryotic translation elongation factor 1 complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0045335 [CC]phagocytic vesicleprobableGO:0005737, GO:0005575, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0030139, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0005938 [CC]cell cortexprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0044424
GO:0003746 [MF]translation elongation factor activityprobableGO:0097159, GO:0008135, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0005773 [CC]vacuoleprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0048046 [CC]apoplastprobableGO:0005575, GO:0005576
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0003785 [MF]actin monomer bindingprobableGO:0003779, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0009506 [CC]plasmodesmaprobableGO:0055044, GO:0005575, GO:0030054, GO:0005911
GO:0006414 [BP]translational elongationprobableGO:0071704, GO:0044267, GO:0044238, GO:0008152, GO:0044260, GO:1901576, GO:0019538, GO:0009987, GO:0009058, GO:0044237, GO:0043170, GO:0044249, GO:0010467, GO:0009059, GO:0008150, GO:0034645, GO:0006412

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1F60, chain B
Confidence level:very confident
Coverage over the Query: 18-107
View the alignment between query and template
View the model in PyMOL