Diaphorina citri psyllid: psy2448


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-
MPPQELKSRNSGLQISFLSNVSFSFVDLLLYESPPEILLPALKQLCKIFPVDLKARRVFVSAGGLKRVQALKPPAGSELCEAVTMINSYFPEDIVRYYSPRCTDHLLAKVDQFTPQVSLPLITCAPDTPSDMSLGDEEGNWSSPISHVISS
cccHHHHHHHHHHHHHHHHccccHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHcccccccHHHHHHHHHHccccHHHHcccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccc
********RNSGLQISFLSNVSFSFVDLLLYESPPEILLPALKQLCKIFPVDLKARRVFVSAGGLKRVQALKPPAGSELCEAVTMINSYFPEDIVRYYSPRCTDHLLAKVDQFTPQVSLPLIT****************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPPQELKSRNSGLQISFLSNVSFSFVDLLLYESPPEILLPALKQLCKIFPVDLKARRVFVSAGGLKRVQALKPPAGSELCEAVTMINSYFPEDIVRYYSPRCTDHLLAKVDQFTPQVSLPLITCAPDTPSDMSLGDEEGNWSSPISHVISS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Sperm-associated antigen 6 Important for structural integrity of the central apparatus in the sperm tail and for flagellar motility.confidentQ9JLI7
Sperm-associated antigen 6 Important for structural integrity of the central apparatus in the sperm tail and for flagellar motility.confidentO75602

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0007283 [BP]spermatogenesisprobableGO:0044702, GO:0048609, GO:0032504, GO:0019953, GO:0022414, GO:0032501, GO:0008150, GO:0044699, GO:0048232, GO:0007276, GO:0000003
GO:0015630 [CC]microtubule cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4HXT, chain A
Confidence level:confident
Coverage over the Query: 3-81
View the alignment between query and template
View the model in PyMOL
Template: 4DB6, chain A
Confidence level:probable
Coverage over the Query: 3-112
View the alignment between query and template
View the model in PyMOL