Diaphorina citri psyllid: psy2450

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250----
MEKWAKTLNHRKEISKVANNTEQAASESPSQSTQGSADVCFSVVGNNREEKTKKSLVAAYESDEEPEVQEETVSGEEKQQIDWDKLACLICKRQFNSKDILKKHTQLSELHKSNLKMWYTCRNLDPNDAVHRAVQYRDRAKERRLKYGEPEVPPACKLKAKYSKVKEATVTFEEPTKKGIGADNVGNKLLQKMGWTQGQGLGKTNQGRTSIIEAEARISSAGLGTNAIGMTPAPGETYKDCVKKMMRARYSQID
cHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHcHHHHHHHHccccccccccHHHHHccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccEEEccccccccccccccccccccHHHHHHHHHHHHHHHHcc
*EKWAK**************************************************************************IDWDKLACLICKRQFNSKDILKKHTQLSELHKSNLKMWYTCRNLDP********QYR********************************************ADNVGNKLLQ*M*W*Q*******************************************CVKKMMRARYS***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEKWAKTLNHRKEISKVANNTEQAASESPSQSTQGSADVCFSVVGNNREEKTKKSLVAAYESDEEPEVQEETVSGEEKQQIDWDKLACLICKRQFNSKDILKKHTQLSELHKSNLKMWYTCRNLDPNDAVHRAVQYRDRAKERRLKYGEPEVPPACKLKAKYSKVKEATVTFEEPTKKGIGADNVGNKLLQKMGWTQGQGLGKTNQGRTSIIEAEARISSAGLGTNAIGMTPAPGETYKDCVKKMMRARYSQID

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044428 [CC]nuclear partprobableGO:0005575, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1ZR9, chain A
Confidence level:probable
Coverage over the Query: 77-120
View the alignment between query and template
View the model in PyMOL