Psyllid ID: psy2450

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250----
MEKWAKTLNHRKEISKVANNTEQAASESPSQSTQGSADVCFSVVGNNREEKTKKSLVAAYESDEEPEVQEETVSGEEKQQIDWDKLACLICKRQFNSKDILKKHTQLSELHKSNLKMWYTCRNLDPNDAVHRAVQYRDRAKERRLKYGEPEVPPACKLKAKYSKVKEATVTFEEPTKKGIGADNVGNKLLQKMGWTQGQGLGKTNQGRTSIIEAEARISSAGLGTNAIGMTPAPGETYKDCVKKMMRARYSQID
cHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHcHHHHHHHHcccccccccHHHHHHHccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccEEEccccccccccccccccccccHHHHHHHHHHHHHHHHcc
cHHHHHHHHHHHHHHHcccccccccccccccHHHHHHcccHHHHccccccccccccccccccccccccccccccccHHHcccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccEccEEEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHcc
MEKWAKTLNHRKEISKVANnteqaasespsqstqgsadVCFSVVGNNREEKTKKSLVAAyesdeepevqeetvsgeekqqiDWDKLACLICKRQFNSKDILKKHTQLSELHKsnlkmwytcrnldpndavhRAVQYRDRAKERrlkygepevppacklkakysKVKEatvtfeeptkkgigadnvGNKLLQKmgwtqgqglgktnqgrTSIIEAEARIssaglgtnaigmtpapgetYKDCVKKMMRARYSQID
mekwaktlnhrkeISKVANNTEQAasespsqstqgsaDVCFSVVGNNREEKTKKSLVaayesdeepevqeetvsgeekqqidWDKLACLICKRQFNSKDILKKHTQLSELHKSNLKMWYTCRNLDPNDAVHRAVQYRDRAkerrlkygepevppacklkakyskVKEAtvtfeeptkkgigadnVGNKLLQKMGwtqgqglgktnqGRTSIIEAEARissaglgtnaigmtpapgetykdCVKKMMRARYSQID
MEKWAKTLNHRKEISKVANNTEQAASESPSQSTQGSADVCFSVVGNNREEKTKKSLVAAYESDEEPEVQEETVSGEEKQQIDWDKLACLICKRQFNSKDILKKHTQLSELHKSNLKMWYTCRNLDPNDAVHRAVQYRDRAKERRLKYGEPEVPPACKLKAKYSKVKEATVTFEEPTKKGIGADNVGNKLLQKMGWTQGQGLGKTNQGRTSIIEAEARISSAGLGTNAIGMTPAPGETYKDCVKKMMRARYSQID
***************************************CF***************************************IDWDKLACLICKRQFNSKDILKKHTQLSELHKSNLKMWYTCRNLDPNDAVHRAVQYR************************Y******TVT********IGADNVGNKLLQKMGWTQ*********************************************************
*EKWAK***************************************************************************DWDKLACLICKRQF*************************************************************************************************************************************************CVKKMMRARYS***
MEKWAKTLNHRKEISKV********************DVCFSVVGNNREEKTKKSLV**********************QIDWDKLACLICKRQFNSKDILKKHTQLSELHKSNLKMWYTCRNLDPNDAVHRAVQYRDRAKERRLKYGEPEVPPACKLKAKYSKVKEATVTFEEPTKKGIGADNVGNKLLQKMGWTQGQGLGKTNQGRTSIIEAEARISSAGLGTNAIGMTPAPGETYKDCVKKMMRARYSQID
*****************************************************************************KQQIDWDKLACLICKRQFNSKDILKKHTQLSELHKSNLKMWYTCRNLDP********QYRDRAKERRLKYGEP*******************************ADNVGNKLLQ*M*W*Q*******NQGRTSIIEAEARISSAGLGTNAIGMTPAPGETYKDCVKKMMRARYSQID
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEKWAKTLNHRKEISKVANNTEQAASESPSQSTQGSADVCFSVVGNNREEKTKKSLVAAYESDEEPEVQEETVSGEEKQQIDWDKLACLICKRQFNSKDILKKHTQLSELHKSNLKMWYTCRNLDPNDAVHRAVQYRDRAKERRLKYGEPEVPPACKLKAKYSKVKEATVTFEEPTKKGIGADNVGNKLLQKMGWTQGQGLGKTNQGRTSIIEAEARISSAGLGTNAIGMTPAPGETYKDCVKKMMRARYSQID
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query254 2.2.26 [Sep-21-2011]
A4IGK4838 RNA-binding protein 5 OS= yes N/A 0.972 0.294 0.391 3e-46
P52756815 RNA-binding protein 5 OS= yes N/A 0.968 0.301 0.417 5e-46
B2GV05815 RNA-binding protein 5 OS= yes N/A 0.968 0.301 0.414 9e-46
Q91YE7815 RNA-binding protein 5 OS= yes N/A 0.968 0.301 0.414 1e-45
Q1RMU5815 RNA-binding protein 5 OS= yes N/A 0.968 0.301 0.414 1e-45
A0JMV4833 RNA-binding protein 5-A O N/A N/A 0.964 0.294 0.390 2e-44
Q99KG3930 RNA-binding protein 10 OS no N/A 0.968 0.264 0.375 2e-41
P70501852 RNA-binding protein 10 OS no N/A 0.968 0.288 0.375 2e-41
P98175930 RNA-binding protein 10 OS no N/A 0.960 0.262 0.379 2e-41
Q6DDU9749 RNA-binding protein 5-B O N/A N/A 0.456 0.154 0.471 6e-24
>sp|A4IGK4|RBM5_XENTR RNA-binding protein 5 OS=Xenopus tropicalis GN=rbm5 PE=2 SV=1 Back     alignment and function desciption
 Score =  185 bits (469), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 110/281 (39%), Positives = 160/281 (56%), Gaps = 34/281 (12%)

Query: 1   MEKWAKTLNHRKEISKVANNTEQAASESPSQSTQGSADVCFSV----------------- 43
           ME+WAK+LN +KE  K  N+ +  ++    +    +AD  F++                 
Sbjct: 565 MERWAKSLNKQKENFK--NSFQPLSARDEERKESAAADAGFALFEKKQGALLERQFMPDM 622

Query: 44  ---VGNNREEKT-KKSLVAAYESDEEPEVQEETVSG--EEKQQIDWDKLACLICKRQFNS 97
              V    EEK   K+LVAAY  D + E + E + G  +E++ +DW KLACL+C+RQF +
Sbjct: 623 MMMVNTEEEEKPPNKALVAAYSGDSDNEEESERLLGAVDEEKLLDWKKLACLLCRRQFPN 682

Query: 98  KDILKKHTQLSELHKSNLKMWYTCR----NLDPNDAVHRAVQYRDRAKERRLKYGEPEVP 153
           KD L +H QLS+LHK NL+++   +     L+  +   R  +YRDRA ERR KYG PE P
Sbjct: 683 KDALTRHQQLSDLHKQNLEVYRRSKMSEQELEALELKEREAKYRDRAAERREKYGIPE-P 741

Query: 154 PACKLKAKYSKVKEATVTFEEPTKKGIGADNVGNKLLQKMGWTQGQGLGKTNQGRTSIIE 213
           P  K K    +     V +E+PTK GI   N+GNK+LQ MGW +G GLG+ +QG T+ I+
Sbjct: 742 PEPKRK----RFDPTVVNYEQPTKDGIDNSNIGNKMLQAMGWKEGSGLGRKSQGITAPIQ 797

Query: 214 AEARISSAGLGTNAIGMTPAPGETYKDCVKKMMRARYSQID 254
           A+ R+  AGLG           ++YKD V+K M AR+S+++
Sbjct: 798 AQVRMRGAGLGAKGSSYGVNTSDSYKDAVRKAMFARFSEME 838
Component of the spliceosome A complex. Regulates alternative splicing of a number of mRNAs. May modulate splice site pairing after recruitment of the U1 and U2 snRNPs to the 5' and 3' splice sites of the intron.
Xenopus tropicalis (taxid: 8364)
>sp|P52756|RBM5_HUMAN RNA-binding protein 5 OS=Homo sapiens GN=RBM5 PE=1 SV=2 Back     alignment and function description
>sp|B2GV05|RBM5_RAT RNA-binding protein 5 OS=Rattus norvegicus GN=Rbm5 PE=2 SV=1 Back     alignment and function description
>sp|Q91YE7|RBM5_MOUSE RNA-binding protein 5 OS=Mus musculus GN=Rbm5 PE=1 SV=1 Back     alignment and function description
>sp|Q1RMU5|RBM5_BOVIN RNA-binding protein 5 OS=Bos taurus GN=RBM5 PE=2 SV=1 Back     alignment and function description
>sp|A0JMV4|RBM5A_XENLA RNA-binding protein 5-A OS=Xenopus laevis GN=rbm5-a PE=2 SV=1 Back     alignment and function description
>sp|Q99KG3|RBM10_MOUSE RNA-binding protein 10 OS=Mus musculus GN=Rbm10 PE=1 SV=1 Back     alignment and function description
>sp|P70501|RBM10_RAT RNA-binding protein 10 OS=Rattus norvegicus GN=Rbm10 PE=2 SV=1 Back     alignment and function description
>sp|P98175|RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 Back     alignment and function description
>sp|Q6DDU9|RBM5B_XENLA RNA-binding protein 5-B OS=Xenopus laevis GN=rbm5-b PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query254
193629689 913 PREDICTED: RNA-binding protein 5-like is 0.980 0.272 0.570 4e-76
307207090 962 RNA-binding protein 10 [Harpegnathos sal 0.996 0.262 0.543 1e-74
322803063 868 hypothetical protein SINV_03072 [Solenop 0.996 0.291 0.543 2e-74
332023596 911 RNA-binding protein 5 [Acromyrmex echina 0.996 0.277 0.543 2e-74
340709219 920 PREDICTED: LOW QUALITY PROTEIN: RNA-bind 0.996 0.275 0.545 2e-74
350425190 924 PREDICTED: RNA-binding protein 10-like [ 0.996 0.273 0.545 3e-74
380027082 920 PREDICTED: RNA-binding protein 10-like [ 0.996 0.275 0.545 5e-74
383864801 920 PREDICTED: RNA-binding protein 10-like i 0.996 0.275 0.541 5e-74
383864803 914 PREDICTED: RNA-binding protein 10-like i 0.996 0.276 0.541 6e-74
328792239 921 PREDICTED: RNA-binding protein 10-like i 0.996 0.274 0.545 6e-74
>gi|193629689|ref|XP_001945723.1| PREDICTED: RNA-binding protein 5-like isoform 1 [Acyrthosiphon pisum] gi|328704881|ref|XP_003242630.1| PREDICTED: RNA-binding protein 5-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  290 bits (742), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 145/254 (57%), Positives = 183/254 (72%), Gaps = 5/254 (1%)

Query: 1   MEKWAKTLNHRKEISKVANNTEQAASESPSQSTQGSADVCFSVVGNNREEKTKKSLVAAY 60
           MEKWAKTLN +K  +K      Q A ++    TQ +AD+ +SV+G   E K ++  VA+ 
Sbjct: 661 MEKWAKTLNQKKISAKQNLVASQVAIQT--ARTQAAADIGYSVMGTKAEPKRQQFPVAST 718

Query: 61  ESDE--EPEVQEETVSGEEKQQIDWDKLACLICKRQFNSKDILKKHTQLSELHKSNLKMW 118
             D     E+ EE    E++Q  DW KLACL+CKRQF+SK+IL KH Q+S+LHK N++ W
Sbjct: 719 SDDNCYTDEIMEEANRNEDEQHTDWVKLACLLCKRQFSSKEILIKHQQMSDLHKQNIRNW 778

Query: 119 YTCRNLDPNDAVHRAVQYRDRAKERRLKYGEPEVPPACKLKAKYSKVKEATVTFEEPTKK 178
           Y  R LDP+D   R +QYRDRAKERR+KY EP+  P   LK KY K KEATV +E+PTK 
Sbjct: 779 YNERGLDPDDESKRVIQYRDRAKERRMKYNEPD-KPLNNLKDKYMKAKEATVDYEQPTKL 837

Query: 179 GIGADNVGNKLLQKMGWTQGQGLGKTNQGRTSIIEAEARISSAGLGTNAIGMTPAPGETY 238
           GIG+DN GNKLLQKMGW +G GLGK+NQGRT+IIEAE R+++AGLGT A+G+ P P ETY
Sbjct: 838 GIGSDNKGNKLLQKMGWQEGMGLGKSNQGRTTIIEAEGRLANAGLGTRAVGVVPGPRETY 897

Query: 239 KDCVKKMMRARYSQ 252
           KDCVKKMMR RY++
Sbjct: 898 KDCVKKMMRYRYNE 911

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|307207090|gb|EFN84899.1| RNA-binding protein 10 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|322803063|gb|EFZ23151.1| hypothetical protein SINV_03072 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|332023596|gb|EGI63829.1| RNA-binding protein 5 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|340709219|ref|XP_003393209.1| PREDICTED: LOW QUALITY PROTEIN: RNA-binding protein 10-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350425190|ref|XP_003494041.1| PREDICTED: RNA-binding protein 10-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|380027082|ref|XP_003697262.1| PREDICTED: RNA-binding protein 10-like [Apis florea] Back     alignment and taxonomy information
>gi|383864801|ref|XP_003707866.1| PREDICTED: RNA-binding protein 10-like isoform 1 [Megachile rotundata] Back     alignment and taxonomy information
>gi|383864803|ref|XP_003707867.1| PREDICTED: RNA-binding protein 10-like isoform 2 [Megachile rotundata] Back     alignment and taxonomy information
>gi|328792239|ref|XP_394165.4| PREDICTED: RNA-binding protein 10-like isoform 1 [Apis mellifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query254
UNIPROTKB|A4IGK4838 rbm5 "RNA-binding protein 5" [ 0.814 0.247 0.438 2.3e-43
UNIPROTKB|A0JMV4833 rbm5-a "RNA-binding protein 5- 0.972 0.296 0.400 3.1e-43
UNIPROTKB|F1SPQ8815 RBM5 "Uncharacterized protein" 0.807 0.251 0.470 5.9e-43
UNIPROTKB|P52756815 RBM5 "RNA-binding protein 5" [ 0.807 0.251 0.466 1.6e-42
UNIPROTKB|Q1RMU5815 RBM5 "RNA-binding protein 5" [ 0.807 0.251 0.461 3.4e-42
UNIPROTKB|E2QUP3815 RBM5 "Uncharacterized protein" 0.807 0.251 0.461 3.4e-42
MGI|MGI:1933204815 Rbm5 "RNA binding motif protei 0.807 0.251 0.461 3.4e-42
RGD|1305059815 Rbm5 "RNA binding motif protei 0.807 0.251 0.461 3.4e-42
FB|FBgn00313181004 CG4887 [Drosophila melanogaste 0.665 0.168 0.455 2.3e-41
FB|FBgn0031319968 CG4896 [Drosophila melanogaste 0.716 0.188 0.445 4.1e-41
UNIPROTKB|A4IGK4 rbm5 "RNA-binding protein 5" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
 Score = 454 (164.9 bits), Expect = 2.3e-43, Sum P(2) = 2.3e-43
 Identities = 96/219 (43%), Positives = 136/219 (62%)

Query:    43 VVGNNREEKT-KKSLVAAYESDEEPEVQEETVSG--EEKQQIDWDKLACLICKRQFNSKD 99
             +V    EEK   K+LVAAY  D + E + E + G  +E++ +DW KLACL+C+RQF +KD
Sbjct:   625 MVNTEEEEKPPNKALVAAYSGDSDNEEESERLLGAVDEEKLLDWKKLACLLCRRQFPNKD 684

Query:   100 ILKKHTQLSELHKSNLKMWYTCR----NLDPNDAVHRAVQYRDRAKERRLKYGEPEVPPA 155
              L +H QLS+LHK NL+++   +     L+  +   R  +YRDRA ERR KYG PE PP 
Sbjct:   685 ALTRHQQLSDLHKQNLEVYRRSKMSEQELEALELKEREAKYRDRAAERREKYGIPE-PPE 743

Query:   156 CKLKAKYSKVKEATVTFEEPTKKGIGADNVGNKLLQKMGWTQGQGLGKTNQGRTSIIEAE 215
              K K    +     V +E+PTK GI   N+GNK+LQ MGW +G GLG+ +QG T+ I+A+
Sbjct:   744 PKRK----RFDPTVVNYEQPTKDGIDNSNIGNKMLQAMGWKEGSGLGRKSQGITAPIQAQ 799

Query:   216 ARISSAGLGTNAIGMTPAPGETYKDCVKKMMRARYSQID 254
              R+  AGLG           ++YKD V+K M AR+S+++
Sbjct:   800 VRMRGAGLGAKGSSYGVNTSDSYKDAVRKAMFARFSEME 838
GO:0000245 "spliceosomal complex assembly" evidence=ISS
GO:0000381 "regulation of alternative mRNA splicing, via spliceosome" evidence=ISS
GO:0003729 "mRNA binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISS
GO:0043065 "positive regulation of apoptotic process" evidence=ISS
UNIPROTKB|A0JMV4 rbm5-a "RNA-binding protein 5-A" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|F1SPQ8 RBM5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P52756 RBM5 "RNA-binding protein 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q1RMU5 RBM5 "RNA-binding protein 5" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2QUP3 RBM5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1933204 Rbm5 "RNA binding motif protein 5" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1305059 Rbm5 "RNA binding motif protein 5" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
FB|FBgn0031318 CG4887 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0031319 CG4896 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query254
smart0044347 smart00443, G_patch, glycine rich nucleic binding 1e-12
pfam0158545 pfam01585, G-patch, G-patch domain 4e-12
pfam1265679 pfam12656, G-patch_2, DExH-box splicing factor bin 6e-07
>gnl|CDD|197727 smart00443, G_patch, glycine rich nucleic binding domain Back     alignment and domain information 
 Score = 60.3 bits (147), Expect = 1e-12
 Identities = 24/47 (51%), Positives = 28/47 (59%)

Query: 180 IGADNVGNKLLQKMGWTQGQGLGKTNQGRTSIIEAEARISSAGLGTN 226
           I   N+G KLL+KMGW +GQGLGK  QG    I AE +    GLG  
Sbjct: 1   ISTSNIGAKLLRKMGWKEGQGLGKNEQGIVEPISAEIKKDRKGLGAV 47

A predicted glycine rich nucleic binding domain found in the splicing factor 45, SON DNA binding protein and D-type Retrovirus- polyproteins. Length = 47
>gnl|CDD|144978 pfam01585, G-patch, G-patch domain Back     alignment and domain information
>gnl|CDD|221692 pfam12656, G-patch_2, DExH-box splicing factor binding site Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 254
KOG0154|consensus573 99.93
PF0158545 G-patch: G-patch domain; InterPro: IPR000467 The D 99.51
smart0044347 G_patch glycine rich nucleic binding domain. A pre 99.38
KOG2809|consensus 326 99.25
KOG0965|consensus988 99.24
KOG2384|consensus223 99.07
PF1265677 G-patch_2: DExH-box splicing factor binding site 98.77
KOG2184|consensus 767 98.67
KOG3673|consensus 845 98.41
KOG1996|consensus378 98.24
KOG2185|consensus 486 98.13
KOG1994|consensus 268 97.89
KOG4315|consensus 455 97.36
KOG4368|consensus757 96.92
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 96.4
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 96.39
KOG0717|consensus508 96.28
KOG2138|consensus 883 94.84
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 94.44
KOG1994|consensus 268 93.71
PTZ00448373 hypothetical protein; Provisional 92.43
KOG2505|consensus 591 92.33
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 92.18
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 91.62
KOG3408|consensus129 91.32
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 90.16
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 89.63
smart0035526 ZnF_C2H2 zinc finger. 85.4
PLN02748468 tRNA dimethylallyltransferase 83.72
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 83.67
KOG2785|consensus 390 82.93
>KOG0154|consensus Back     alignment and domain information 
Probab=99.93  E-value=3.4e-26  Score=226.73  Aligned_cols=233  Identities=34%  Similarity=0.490  Sum_probs=175.2

Q ss_pred             ChhhhhhhhhhhccccC--CCCcccccCCCCCccccCCCCccccccccccccc-------------------cchhhhhh
Q psy2450           1 MEKWAKTLNHRKEISKV--ANNTEQAASESPSQSTQGSADVCFSVVGNNREEK-------------------TKKSLVAA   59 (254)
Q Consensus         1 me~wak~ln~~ke~~~~--~~~~~~~~~~~~~~~~~~~ad~gf~~~e~k~~~~-------------------~~~~l~~~   59 (254)
                      |++|++.++.+++....  .+..   ....+....+..+..+.-..+++....                   ...+|+..
T Consensus       311 ~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  387 (573)
T KOG0154|consen  311 MEKWAKYLSKEKDSYLLSSTPAH---EGVHTGVNTSKGAEPGPVKKEKKLYKKKEKFVNPELSKRGSHVSPSKNLKLIDV  387 (573)
T ss_pred             HHhhhhhhhcccccccccccccc---eecccccccccccCchhhhhhccccccchhccCccccccccccCcccccccccc
Confidence            89999999988886655  2221   122334444444555544333322111                   13578999


Q ss_pred             ccCCCCchhhhccccccccccccccCccccccccCCCCHHHHHhhhhhhHHHHhhhhhhhhhcCCCCCchhccccccchh
Q psy2450          60 YESDEEPEVQEETVSGEEKQQIDWDKLACLICKRQFNSKDILKKHTQLSELHKSNLKMWYTCRNLDPNDAVHRAVQYRDR  139 (254)
Q Consensus        60 y~~~sd~e~~~~~~~~~e~~~~D~~kl~ClLC~RqF~s~e~L~kH~~~S~LHk~NL~~~~~~k~~~~~~~~~~~~~YRDR  139 (254)
                      |.|.++++.+.+..    ..+++|.+++|+||+|+|++.+.+++|...|.+|++||..++.....+ .........|+||
T Consensus       388 ~~~~~~~~~~~~~~----~~~~~~~~~~~~l~r~~~~~~~~~~~~~~~s~~h~~n~~~~~~~~~~~-~~~~~~~~~~~~~  462 (573)
T KOG0154|consen  388 STGLSDSELEQEKS----LKLVDKLKLMCLLCRRQFPSKGSLQKHLTPSDLHKENLDKHRRPSTLE-EASAEGPLAYRDR  462 (573)
T ss_pred             ccCCCchHhhhhhh----hhccccchhhhhhhhccCCchHHHhhhcccccchhhhHHhhccchhhh-hhccccccccchH
Confidence            99999998876542    289999999999999999999999999999999999999999876543 2233456899999


Q ss_pred             HHHHhhhcCCCCCCcccccccc-cccccccccccCC--------CccCCCCCCcHHHHHHHHcCCCCCCCCCCCCCCccc
Q psy2450         140 AKERRLKYGEPEVPPACKLKAK-YSKVKEATVTFEE--------PTKKGIGADNVGNKLLQKMGWTQGQGLGKTNQGRTS  210 (254)
Q Consensus       140 A~ERR~~~G~~~~P~~~~~r~k-~~~~~~~~~~~e~--------~~~~~~~~sn~G~kmL~kMGW~~G~GLGk~~qG~~~  210 (254)
                      +.+||..+|...++.+....-. |..   .......        -...+|+.+|+|.+||++|||.+|+|||...+|++.
T Consensus       463 ~~~~~~~~g~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~sn~~~~~l~~~gw~~g~Glg~~~~g~~~  539 (573)
T KOG0154|consen  463 AKERRKSMGIVEGRGPGRSKPDSFEP---ISVLLESRQKSSRGATEEPPIDTSNVGNRMLQSMGWKEGSGLGKKNQGIKE  539 (573)
T ss_pred             HHhHHHHhcCCCCCCCCcccCCCccc---ceeeccccccchhhccccccCCCCccchhhhhccCcccccccccccCCCcc
Confidence            9999999999987665521111 111   1111111        123358899999999999999999999999999999


Q ss_pred             cceeeeecCCceecccCCCCCCCCCchHHHHHHHHH
Q psy2450         211 IIEAEARISSAGLGTNAIGMTPAPGETYKDCVKKMM  246 (254)
Q Consensus       211 PI~~~~~~~~~GLG~~~~~~~~~~~d~Y~~~vrk~~  246 (254)
                      ||++..+..++|||+. ..+.....+ |+++++++|
T Consensus       540 ~~e~~~~~~~~~lg~~-~~~~~~~~~-~~~~~~k~~  573 (573)
T KOG0154|consen  540 PIEAEGRDRGAGLGAK-SKQGVKGND-YKEAKRKKM  573 (573)
T ss_pred             cccccccccCCCCCcc-cccccCCcc-hhhhhhccC
Confidence            9999999999999999 777778888 999999875

>PF01585 G-patch: G-patch domain; InterPro: IPR000467 The D111/G-patch domain [] is a short conserved region of about 40 amino acids which occurs in a number of putative RNA-binding proteins, including tumor suppressor and DNA-damage-repair proteins, suggesting that this domain may have an RNA binding function Back     alignment and domain information
>smart00443 G_patch glycine rich nucleic binding domain Back     alignment and domain information
>KOG2809|consensus Back     alignment and domain information
>KOG0965|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>PF12656 G-patch_2: DExH-box splicing factor binding site Back     alignment and domain information
>KOG2184|consensus Back     alignment and domain information
>KOG3673|consensus Back     alignment and domain information
>KOG1996|consensus Back     alignment and domain information
>KOG2185|consensus Back     alignment and domain information
>KOG1994|consensus Back     alignment and domain information
>KOG4315|consensus Back     alignment and domain information
>KOG4368|consensus Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG0717|consensus Back     alignment and domain information
>KOG2138|consensus Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>KOG1994|consensus Back     alignment and domain information
>PTZ00448 hypothetical protein; Provisional Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>KOG3408|consensus Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PLN02748 tRNA dimethylallyltransferase Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query254
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 44.8 bits (105), Expect = 1e-05
 Identities = 22/209 (10%), Positives = 60/209 (28%), Gaps = 64/209 (30%)

Query: 1   MEKWAKTLNHRKEISKVANNTEQAASESPSQSTQGSADVCFSVVG------NNR------ 48
           ++  + TL   +  S +    +    + P +    +     S++                
Sbjct: 291 LDHHSMTLTPDEVKSLLLKYLDCRPQDLPREVLTTNPRRL-SIIAESIRDGLATWDNWKH 349

Query: 49  --EEKTKKSLVAAYESDEEPEVQE---------ETV--------------SGEEKQQIDW 83
              +K    + ++    E  E ++          +                  +   +  
Sbjct: 350 VNCDKLTTIIESSLNVLEPAEYRKMFDRLSVFPPSAHIPTILLSLIWFDVIKSDVMVVV- 408

Query: 84  DKLA--CLICKRQFNSK--------DILKKHTQLSELHKSNLKMWYTCRNLDPNDAV--- 130
           +KL    L+ K+   S         ++  K      LH+S +  +   +  D +D +   
Sbjct: 409 NKLHKYSLVEKQPKESTISIPSIYLELKVKLENEYALHRSIVDHYNIPKTFDSDDLIPPY 468

Query: 131 -----------H-RAVQYRDRAKERRLKY 147
                      H + +++ +R    R+ +
Sbjct: 469 LDQYFYSHIGHHLKNIEHPERMTLFRMVF 497

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query254
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.77
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 91.75
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 91.54
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 91.42
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 90.59
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 90.48
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 90.26
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 90.22
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 90.12
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 90.09
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 90.04
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 90.01
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 89.77
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 89.7
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 89.7
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 89.7
1ard_A29 Yeast transcription factor ADR1; transcription reg 89.63
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 89.58
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 89.31
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 89.3
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 89.23
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 89.23
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 89.21
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 89.19
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 89.16
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 89.16
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 89.12
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 89.11
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 89.05
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 89.04
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 89.01
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 88.97
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 88.92
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 88.9
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 88.86
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 88.83
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 88.8
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 88.72
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 88.72
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 88.69
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 88.69
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 88.55
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 88.52
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 88.4
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 88.32
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 88.24
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 88.21
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 88.21
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 88.19
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 88.12
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 88.08
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 88.05
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 88.01
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 87.89
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 87.82
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 87.79
1wir_A121 Protein arginine N-methyltransferase 3; C2H2 zinc 87.77
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 87.69
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 87.62
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 87.62
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 87.59
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 87.54
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 87.54
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 87.41
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 87.41
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 87.37
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 87.35
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 87.31
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 87.3
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 87.18
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 87.13
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 87.11
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 87.08
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 86.98
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 86.97
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 86.94
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 86.91
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 86.91
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 86.91
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 86.88
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 86.8
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 86.79
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 86.8
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 86.76
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 86.72
2e72_A49 POGO transposable element with ZNF domain; zinc fi 86.7
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 86.67
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 86.62
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 86.6
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 86.59
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 86.4
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 86.35
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 86.33
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 86.27
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 86.26
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 86.21
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 86.21
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 86.2
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 86.18
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 86.18
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 86.14
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 86.09
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 86.08
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 85.96
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 85.96
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 85.85
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 85.84
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 85.8
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 85.78
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 85.76
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 85.66
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 85.57
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 85.55
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 85.42
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 85.6
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 85.35
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 85.3
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 85.23
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 85.17
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 85.07
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 84.96
1paa_A30 Yeast transcription factor ADR1; transcription reg 84.92
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 84.86
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 84.76
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 84.72
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 84.71
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 84.87
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 84.4
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 84.39
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 84.26
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 84.05
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 84.03
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 84.01
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 82.81
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 82.78
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 82.48
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 81.94
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 81.43
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 80.88
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 80.06
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
Probab=95.77  E-value=0.0048  Score=49.85  Aligned_cols=43  Identities=30%  Similarity=0.361  Sum_probs=38.6

Q ss_pred             ccccccccCccccccccCCCCHHHHHhhhhhhHHHHhhhhhhhh
Q psy2450          77 EKQQIDWDKLACLICKRQFNSKDILKKHTQLSELHKSNLKMWYT  120 (254)
Q Consensus        77 e~~~~D~~kl~ClLC~RqF~s~e~L~kH~~~S~LHk~NL~~~~~  120 (254)
                      +..++....+.|..|.+.|.+...|..|++ |..|+.+++.++.
T Consensus        42 ded~tGekpfyC~~C~K~F~~~~~L~~H~r-sK~HKrrvk~l~~   84 (124)
T 1zr9_A           42 DPDLPGGGLHRCLACARYFIDSTNLKTHFR-SKDHKKRLKQLSV   84 (124)
T ss_dssp             CSSSGGGGCSEETTTTEECSSHHHHHHHTT-CHHHHHHHHHHTS
T ss_pred             cccCCCCcceEcccCcchhCCHHHHHHHHh-hhhhhHHHHHhcc
Confidence            455777789999999999999999999997 9999999999875
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1wir_A Protein arginine N-methyltransferase 3; C2H2 zinc finger domain, PRMT3, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.37.1.5 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query254
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 97.36
d1wjpa341 Zinc finger protein 295, ZNF295 {Human (Homo sapie 97.18
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 96.42
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 95.2
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 93.62
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 91.37
d1wira_121 Protein arginine N-methyltransferase 3 {Mouse (Mus 89.45
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 89.31
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 88.37
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 88.25
d2cota238 Zinc finger and SCAN domain-containing protein 16, 87.82
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 87.67
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 86.93
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 85.8
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 85.79
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 83.24
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 81.01
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: HkH motif-containing C2H2 finger
domain: Zinc finger protein 593, ZNF593
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.36  E-value=5.1e-05  Score=53.65  Aligned_cols=40  Identities=33%  Similarity=0.351  Sum_probs=35.8

Q ss_pred             ccccCccccccccCCCCHHHHHhhhhhhHHHHhhhhhhhhh
Q psy2450          81 IDWDKLACLICKRQFNSKDILKKHTQLSELHKSNLKMWYTC  121 (254)
Q Consensus        81 ~D~~kl~ClLC~RqF~s~e~L~kH~~~S~LHk~NL~~~~~~  121 (254)
                      -..+...|..|.|.|.|...|..|++ |.-||.+++.++..
T Consensus        11 pG~gqfYCv~C~K~F~se~~l~~H~k-sKkHKrrvk~L~~~   50 (67)
T d1zr9a1          11 PGGGLHRCLACARYFIDSTNLKTHFR-SKDHKKRLKQLSVE   50 (67)
T ss_dssp             GGGGCSEETTTTEECSSHHHHHHHTT-CHHHHHHHHHHTSC
T ss_pred             CCCCEEecccccCccCCHHHHHHHHc-ccHHHHHHHHhccC
Confidence            34578999999999999999999998 99999999998753
>d1wjpa3 g.37.1.1 (A:67-107) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wira_ g.37.1.5 (A:) Protein arginine N-methyltransferase 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure