Diaphorina citri psyllid: psy2457


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19
MTKKFPPRPGFEPSPSRLVASPRDYLGIRLSDSQCGVNSECNVRNHIPVCSCPPGYTGDPLTQCRRFDPHDLCEPNPCGENAKCQPGYDKSGKDRPVCTCLPGYVGDALTYCRRGECQSDAECNYDQVCNNYNCEKACTSQCGINAQCTARNHVATCSCPAGYQGDALSRCYPAETTSYRRGRVYYNKK
cccccccccccccccccccccccccccccccccccccccEEEEcccccEEEcccccCCccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccEEEEccccEEEEccccccccccccccccccccccccccccccc
***************SRLVASPRDYLGIRLSDSQCGVNSECNVRNHIPVCSCPPGYTGDPLTQCRRFDPHDLCEPNPCGENAKCQPGYDKSGKDRPVCTCLPGYVGDALTYCRRGECQSDAECNYDQVCNNYNCEKACTSQCGINAQCTARNHVATCSCPAGYQGDALSRCYPAETTSYRRGRVYY***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTKKFPPRPGFEPSPSRLVASPRDYLGIRLSDSQCGVNSECNVRNHIPVCSCPPGYTGDPLTQCRRFDPHDLCEPNPCGENAKCQPGYDKSGKDRPVCTCLPGYVGDALTYCRRGECQSDAECNYDQVCNNYNCEKACTSQCGINAQCTARNHVATCSCPAGYQGDALSRCYPAETTSYRRGRVYYNKK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005488 [MF]bindingprobableGO:0003674
GO:0080090 [BP]regulation of primary metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0048522 [BP]positive regulation of cellular processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0009966 [BP]regulation of signal transductionprobableGO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0048513 [BP]organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0031982 [CC]vesicleprobableGO:0005575, GO:0043226
GO:0044767 [BP]single-organism developmental processprobableGO:0032502, GO:0008150, GO:0044699
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0051179 [BP]localizationprobableGO:0008150
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425
GO:0031323 [BP]regulation of cellular metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222, GO:0050794
GO:0048699 [BP]generation of neuronsprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0009987, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0022008, GO:0007275, GO:0044699
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0043229 [CC]intracellular organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0043226
GO:0042221 [BP]response to chemical stimulusprobableGO:0050896, GO:0008150
GO:0005604 [CC]basement membraneprobableGO:0005578, GO:0031012, GO:0005575, GO:0005576, GO:0044420, GO:0044421
GO:0030054 [CC]cell junctionprobableGO:0005575
GO:0060255 [BP]regulation of macromolecule metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0009653 [BP]anatomical structure morphogenesisprobableGO:0032502, GO:0048856, GO:0008150
GO:0032991 [CC]macromolecular complexprobableGO:0005575

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2VJ3, chain A
Confidence level:very confident
Coverage over the Query: 26-126,141-175
View the alignment between query and template
View the model in PyMOL
Template: 2VJ2, chain A
Confidence level:confident
Coverage over the Query: 7-169
View the alignment between query and template
View the model in PyMOL