Diaphorina citri psyllid: psy245


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560------
MELSKIGAIILYRTLVKIWKVAKAGTRSIDPKSMDEKDFALSNGGEPPAREEPRLEPVNGIVQPPTVPPPHRPGRNTNQLAFISKNVLKPVMKHQHAWPFHQPVDAIDLNLPFLIFRFLVFQHWVLSMYIEYPILLAFALTVPVLIILQDYHKVIKHPMDLGTIKKRLENFYYWSGKEAISDFNTMFTNCYVYNKPGEDVVVMAQTLEKLFLTKVSARRESGRQIKKPNRGSDEGSFTTQLATSVTSVGDQGSYAKPKLTESLKYCNEILKELFSKKHSSYAWPFYKPVDAAWLGLNDYHEIIKKPMDLGTVKAKMDAREYKSSKEFADDVRLIFTNCYKYNPPDHDVVAMAKKLQDVFETKIAKAPDDVPIVSSSSMVPTLTVNKNNIGRWSPDSSSDSTDSEADERARKLISLQDQVTPKPATAAQRKKPPTTPLSAPQPASSVKKPARPPAKTPVKRKAPPMPNKSVSAQHTQPAPVMNDESDEESSKPMSYFEKQELSLDINKLPGKKLGRVVHIIQSREPSLRDSNPDEIEIDFETLKPSTLRELEKYVATCLRKKPRKPN
cccccccHHHccccHHEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHccccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccHHHHHHHHHcccccccccccccEEEccccccHHHHHHHHHHHHHHHHHcccccc
****KIGAIILYRTLVKIWKVAK********************************************************LAFISKNVLKPVMKHQHAWPFHQPVDAIDLNLPFLIFRFLVFQHWVLSMYIEYPILLAFALTVPVLIILQDYHKVIKHPMDLGTIKKRLENFYYWSGKEAISDFNTMFTNCYVYNKPGEDVVVMAQTLEKLFLTKVSAR**********************************SYAKPKLTESLKYCNEILKELFSKKHSSYAWPFYKPVDAAWLGLNDYHEIIKKPMDLGTVKAKMDAREYKSSKEFADDVRLIFTNCYKYNPPDHDVVAMAKKLQDVFETKIAKA************************************************************************************************************************************************KKLGRVVHII****************IDFETLKPSTLRELEKYVATC**K******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MELSKIGAIILYRTLVKIWKVAKAGTRSIDPKSMDEKDFALSNGGEPPAREEPRLEPVNGIVQPPTVPPPHRPGRNTNQLAFISKNVLKPVMKHQHAWPFHQPVDAIDLNLPFLIFRFLVFQHWVLSMYIEYPILLAFALTVPVLIILQDYHKVIKHPMDLGTIKKRLENFYYWSGKEAISDFNTMFTNCYVYNKPGEDVVVMAQTLEKLFLTKVSARRESGRQIKKPNRGSDEGSFTTQLATSVTSVGDQGSYAKPKLTESLKYCNEILKELFSKKHSSYAWPFYKPVDAAWLGLNDYHEIIKKPMDLGTVKAKMDAREYKSSKEFADDVRLIFTNCYKYNPPDHDVVAMAKKLQDVFETKIAKAPDDVPIVSSSSMVPTLTVNKNNIGRWSPDSSSDSTDSEADERARKLISLQDQVTPKPATAAQRKKPPTTPLSAPQPASSVKKPARPPAKTPVKRKAPPMPNKSVSAQHTQPAPVMNDESDEESSKPMSYFEKQELSLDINKLPGKKLGRVVHIIQSREPSLRDSNPDEIEIDFETLKPSTLRELEKYVATCLRKKPRKPN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Bromodomain testis-specific protein Testis-specific chromatin protein that specifically binds histone H4 acetylated at 'Lys-5' and 'Lys-8' (H4K5ac and H4K8ac, respectively) and plays a key role in spermatogenesis. Required in late pachytene spermatocytes: plays a role in meiotic and post-meiotic cells by binding to acetylated histones at the promoter of specific meiotic and post-meiotic genes, facilitating their activation at the appropriate time. In the post-meiotic phase of spermatogenesis, binds to hyperacetylated histones and participates in their general removal from DNA.confidentF7DRV9
Bromodomain testis-specific protein May play a role in the transcriptional regulation of spermatogenesis. Seems to have a structural ATP-independent role in the reorganization of acetylated chromatin.confidentQ91Y44
Bromodomain testis-specific protein Testis-specific chromatin protein that specifically binds histone H4 acetylated at 'Lys-5' and 'Lys-8' (H4K5ac and H4K8ac, respectively) and plays a key role in spermatogenesis. Required in late pachytene spermatocytes: plays a role in meiotic and post-meiotic cells by binding to acetylated histones at the promoter of specific meiotic and post-meiotic genes, facilitating their activation at the appropriate time. In the post-meiotic phase of spermatogenesis, binds to hyperacetylated histones and participates in their general removal from DNA. Also acts as a component of the splicing machinery in pachytene spermatocytes and round spermatids and participates in 3'-UTR truncation of specific mRNAs in post-meiotic spermatids. Required for chromocenter organization, a structure comprised of peri-centromeric heterochromatin.confidentD4A7T3

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005694 [CC]chromosomeprobableGO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0006338 [BP]chromatin remodelingprobableGO:0006996, GO:0051276, GO:0006325, GO:0071840, GO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0008150, GO:0016568
GO:0070577 [MF]histone acetyl-lysine bindingprobableGO:0042393, GO:0003674, GO:0005488, GO:0005515
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0006357 [BP]regulation of transcription from RNA polymerase II promoterprobableGO:0009889, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3UV5, chain A
Confidence level:very confident
Coverage over the Query: 76-112,150-230,244-368
View the alignment between query and template
View the model in PyMOL
Template: 2R10, chain A
Confidence level:very confident
Coverage over the Query: 132-243,256-366
View the alignment between query and template
View the model in PyMOL
Template: 2JNS, chain A
Confidence level:very confident
Coverage over the Query: 481-566
View the alignment between query and template
View the model in PyMOL
Template: 2R0V, chain A
Confidence level:probable
Coverage over the Query: 151-267,284-365
View the alignment between query and template
View the model in PyMOL